DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and Ppm1n

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_006539883.1 Gene:Ppm1n / 232941 MGIID:2142330 Length:452 Species:Mus musculus


Alignment Length:366 Identity:138/366 - (37%)
Similarity:214/366 - (58%) Gaps:10/366 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GGFLEKPETEKQAQEGHG--NGLRYCVSSMQGWRLEMEDSHSAACRLKDPFATWSYFAVFDGHAG 68
            |..|..|...::...|..  :|||:..|::||||..|||:|.|...|....:.|::|||.|||.|
Mouse    36 GSLLAAPRCWQRLHRGAAATSGLRFGASAVQGWRARMEDAHCARLALPGLPSGWAFFAVLDGHGG 100

  Fly    69 SQISLHCAEHLMSTILESESFSKHKYEA---GIREGFLQLDEDMRKLY-HDQQGGSTAICVFVSP 129
            ::.:...|.||...:|.....:..:.:.   .:|..|||.|..:..|: ....|||||:.:.|||
Mouse   101 ARAARFGARHLPGYVLGELGPAPQEPDGVRQALRSAFLQADAQLSALWPRGDPGGSTAVALLVSP 165

  Fly   130 DKIYLVNCGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVMIKRINGTLAVSRAFGDYD 194
            ..:||.:||||||::||:|:....|.||:|..|:|:|||.:|||:|..:|:.|:||||||.||:.
Mouse   166 RFLYLAHCGDSRALLSRSGSVAFCTEDHRPHRPRERERIHDAGGTVRRRRVEGSLAVSRALGDFA 230

  Fly   195 FKNDGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDLPMI 259
            :|....:.|..|:||.||::....|.:.|||:::|.||:||.::.:::...:.|||.:..||.::
Mouse   231 YKQAPGRPPELQLVSAEPEVAALARQDEDEFVLLASDGVWDALSGADLAGLVTSRLRLGLDLELL 295

  Fly   260 VNSVLDICLHKGSRDNMTLLLLLLPGAPKVDMDAVKAERSLDQTIVQITKEV-IEKHEIHDFETL 323
            ...:||.||.|||.||||.:::..||||:...:|:..|.:||:.:.....|: ....|.....|:
Mouse   296 CAQLLDTCLCKGSLDNMTCMVVCFPGAPRPCEEAISKEMALDEALSHKVAELYASAQEPPGLNTV 360

  Fly   324 IRLMKRMAINIPNLPPGGGLYAKYYIIEQAFHEKFPDTPAE 364
            .|.:  .:.:||.|||||||::|..:|.:|: .|...||.|
Mouse   361 FRTL--ASEDIPGLPPGGGLHSKAAVIAEAY-SKLHQTPGE 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 102/253 (40%)
PP2C_C 284..352 CDD:285117 23/68 (34%)
Ppm1nXP_006539883.1 PP2Cc 59..319 CDD:238083 104/259 (40%)
PP2C_C 313..387 CDD:369544 24/75 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834859
Domainoid 1 1.000 58 1.000 Domainoid score I10718
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D957254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47992
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X444
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.810

Return to query results.
Submit another query.