DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and ilkp-1

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_496370.2 Gene:ilkp-1 / 185220 WormBaseID:WBGene00009354 Length:322 Species:Caenorhabditis elegans


Alignment Length:336 Identity:92/336 - (27%)
Similarity:160/336 - (47%) Gaps:60/336 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LEKPETEKQAQEGHGNGLRYCV----SSMQGWRLEMEDSHSAACRL-----KDPFATWSYFAVFD 64
            ::..:..|:.:|...   .||.    ...:|.|.:|:|:|....:.     |...:..|:||:||
 Worm    14 IDNSDESKKPKESRN---LYCTLAAYGCRKGERADMQDTHIMLPKFDLGTEKSFLSRASFFAIFD 75

  Fly    65 GHAGSQISLHCAEHLMSTILE---------------SESFSKHKYEAGIREGFLQLDEDMRKLYH 114
            ||||.:.:.||...:..|:.|               .::|:: .|:| :.:|||.:.:..:.::.
 Worm    76 GHAGPRAAEHCQSQMGKTVKEKLAKFSDFPTLTKSLKQTFTE-SYKA-VDDGFLAIAKQNKPIWK 138

  Fly   115 DQQGGSTAICVFVSPDKIYLVNCGDSRAVISR-----NGAAVISTIDHKPFSPKEQERIQNAGGS 174
            |   |:||..:.:..:.||:.|.||||||::|     :.|.|..|:||.|.|..|:.|||.||..
 Worm   139 D---GTTATTMIILNNVIYVANIGDSRAVVARKKEDGSFAPVCLTVDHDPMSHDERMRIQKAGAV 200

  Fly   175 VMIKRINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTS 239
            |...||||.:.|||:.||..||:.|        :...||:.....:::|.|.::||||:|...::
 Worm   201 VKDGRINGVIEVSRSIGDLPFKSLG--------IISTPDLKKLTLTKNDLFAIIACDGLWKSFSN 257

  Fly   240 SEVCEFIRSRLLVT--YDLPMIVNSVLDICLHKGSRDNMTLLLLLLPGAPKVDMDAVKAERSLDQ 302
            .|...|...:|...  .|:....|.         ||:...|.::    |.|:..:||:.:...:.
 Worm   258 LEAVSFAVEQLEAAKKTDIEQEPNE---------SREAAELRVV----AEKLAAEAVRRKCGDNV 309

  Fly   303 TIVQITKEVIE 313
            :::.:..|:|:
 Worm   310 SVIIVKLELID 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 83/280 (30%)
PP2C_C 284..352 CDD:285117 6/30 (20%)
ilkp-1NP_496370.2 PP2Cc 34..316 CDD:238083 86/307 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.