DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and tap-1

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_510428.1 Gene:tap-1 / 181556 WormBaseID:WBGene00006524 Length:386 Species:Caenorhabditis elegans


Alignment Length:326 Identity:79/326 - (24%)
Similarity:123/326 - (37%) Gaps:73/326 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MG--GFLEKPETEKQAQEGHGNGLRYCVSSMQGWRLEMEDSHSAA-CRLKDPFATWSYFAVFDGH 66
            ||  |||::......|..|..:..||   |.|...::..|..|.: |....|...:..|:.|:| 
 Worm     1 MGDDGFLDQYPANTDAGIGTVHSCRY---SKQKNPVQNNDFLSCSMCIHNGPIKLYGIFSGFNG- 61

  Fly    67 AGSQISLHCAEHLMSTILES-------------ESFSKHKYEAGIREGFLQLDED---MRKLYHD 115
             |...:......|:..|...             |.| |.|:| .:.|.:|.::.|   .|.|..:
 Worm    62 -GDSTAKFVMNRLVYEIFGENPITPTLLPYQVVEEF-KRKFE-NVAERYLLMNTDDLNNRLLKLE 123

  Fly   116 QQG----------------GSTAICVFVSPDKIYLVNCGDSRAVI--SRNGAAVISTIDHKPFSP 162
            :|.                |:|||.|.:....:|::|||:|.|:.  |.|...:.|.: |...:|
 Worm   124 EQSETGNNAVSEINQKIRQGTTAIVVMIINQDLYVLNCGNSLAIAMNSENVVQLNSNL-HNNDNP 187

  Fly   163 KEQERIQNAGGSVMIKRIN--GTLAVSRAFGDYD----------FKNDGSKSPVDQMVSPEPDII 215
            .|..||:..|       ||  ..|..:||.||..          |||  :|.|   .|...||:.
 Worm   188 LEIVRIKGLG-------INPETVLNPTRAIGDLQRTHLFEETEAFKN--AKGP---PVISTPDVQ 240

  Fly   216 VCNRSEHDEFIVVACDGIWDVMTSSEVCEF---IRSRLLVTYDLPMIVNSVLDICLHKGSRDNMT 277
            ..........:|:..||:...:...||...   :..||:..:.:.....:::|....| .||..|
 Worm   241 YTKIDPSWRHLVLISDGVVQNLKEVEVENIPTEVSVRLIEDHTVTSTAQALVDSFARK-HRDAYT 304

  Fly   278 L 278
            :
 Worm   305 M 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 71/299 (24%)
PP2C_C 284..352 CDD:285117
tap-1NP_510428.1 PP2Cc 21..327 CDD:238083 72/306 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47992
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.