DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and fem-2

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_497224.1 Gene:fem-2 / 175217 WormBaseID:WBGene00001412 Length:449 Species:Caenorhabditis elegans


Alignment Length:305 Identity:88/305 - (28%)
Similarity:135/305 - (44%) Gaps:48/305 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NGLRYCVSSMQGWRLEMEDSHSA------ACRLKDPFATWSYFAVFDGHAGSQISLHCAEHLMST 82
            :|:......::|.|.:.||...|      ..|.:||.   |..||||||.|.:.|.:.|.||..|
 Worm   159 SGIHVSGDQLKGQRHKQEDRFLAYPNGQYMDRGEDPI---SVLAVFDGHGGHECSQYAAGHLWET 220

  Fly    83 ILE-------SESFSKHKYEAGIREGFLQLDEDM--RKLYHDQQGGSTAICVFVSPDK--IYLVN 136
            .||       |:|.     |..:|:....|||.|  |.:....:|||||:|..:..|:  :.|..
 Worm   221 WLEVRKSRDPSDSL-----EDQLRKSLELLDERMTVRSVKECWKGGSTAVCCAIDMDQKLMALAW 280

  Fly   137 CGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVMI----KRINGTLAVSRAFGDYDFKN 197
            .|||...:..|......|..|.|...:|..|::.|||.:.:    .|:||.|.::||.||.    
 Worm   281 LGDSPGYVMSNIEFRQLTRGHSPSDEREARRVEEAGGQLFVIGGELRVNGVLNLTRALGDV---- 341

  Fly   198 DGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDLPMIVNS 262
                 |...|:|.||:.........|..:::|||||.||....::.:.:.:   ...|.|:...:
 Worm   342 -----PGRPMISNEPETCQVPIESSDYLVLLACDGISDVFNERDLYQLVEA---FANDYPVEDYA 398

  Fly   263 VLD--IC---LHKGSRDNMTLLLLLLPGAPKVDMDAVKAERSLDQ 302
            .|.  ||   :..||.||:::::..|  .|..|:..:....|.|:
 Worm   399 ELSRFICTKAIEAGSADNVSVVIGFL--RPPQDVWKLMKHESDDE 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 82/275 (30%)
PP2C_C 284..352 CDD:285117 4/19 (21%)
fem-2NP_497224.1 PP2C 161..417 CDD:278884 81/275 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.