DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and PPM1N

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001073870.1 Gene:PPM1N / 147699 HGNCID:26845 Length:430 Species:Homo sapiens


Alignment Length:351 Identity:133/351 - (37%)
Similarity:200/351 - (56%) Gaps:12/351 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KQAQEGHG-----NGLRYCVSSMQGWRLEMEDSHSAACRLKDPFATWSYFAVFDGHAGSQISLHC 75
            ::||..||     .|||:..|:.||||..|||:|.....|......|:.|||.|||.|::.:...
Human    50 RRAQRPHGGAEASGGLRFGASAAQGWRARMEDAHCTWLSLPGLPPGWALFAVLDGHGGARAARFG 114

  Fly    76 AEHLMSTILES---ESFSKHKYEAGIREGFLQLDEDMRKLY-HDQQGGSTAICVFVSPDKIYLVN 136
            |.||...:|:.   |..........:|..||..||.:|.|: ..:.||.||:.:.|||..:||.:
Human   115 ARHLPGHVLQELGPEPSEPEGVREALRRAFLSADERLRSLWPRVETGGCTAVVLLVSPRFLYLAH 179

  Fly   137 CGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVMIKRINGTLAVSRAFGDYDFKNDGSK 201
            |||||||:||.||...||.||:|..|:|:|||..|||::..:|:.|:||||||.||:.:|....:
Human   180 CGDSRAVLSRAGAVAFSTEDHRPLRPRERERIHAAGGTIRRRRVEGSLAVSRALGDFTYKEAPGR 244

  Fly   202 SPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDLPMIVNSVLDI 266
            .|..|:||.||::....|...|||:::|.||:||.::.:.:...:.|||.:.....::...:||.
Human   245 PPELQLVSAEPEVAALARQAEDEFMLLASDGVWDTVSGAALAGLVASRLRLGLAPELLCAQLLDT 309

  Fly   267 CLHKGSRDNMTLLLLLLPGAPKVDMDAVKAERSLDQTI-VQITKEVIEKHEIHDFETLIRLMKRM 330
            ||.|||.||||.:|:..||||:...:|::.|.:||..: .:|.:......:.....|:.|.:  .
Human   310 CLCKGSLDNMTCILVCFPGAPRPSEEAIRRELALDAALGCRIAELCASAQKPPSLNTVFRTL--A 372

  Fly   331 AINIPNLPPGGGLYAKYYIIEQAFHE 356
            :.:||:|||||||..|..:|.:.:.:
Human   373 SEDIPDLPPGGGLDCKATVIAEVYSQ 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 102/253 (40%)
PP2C_C 284..352 CDD:285117 22/68 (32%)
PPM1NNP_001073870.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..65 4/14 (29%)
PP2Cc 66..326 CDD:238083 105/259 (41%)
PP2C_C 320..394 CDD:285117 24/75 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 407..430
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144747
Domainoid 1 1.000 55 1.000 Domainoid score I11121
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D262211at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47992
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X444
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.