DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and PPM1M

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_653242.3 Gene:PPM1M / 132160 HGNCID:26506 Length:459 Species:Homo sapiens


Alignment Length:372 Identity:87/372 - (23%)
Similarity:142/372 - (38%) Gaps:123/372 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EKPE-TEKQAQEGHGNGLRYCVSSMQGWRLEM--EDSHSAACRLKDPFATWSYFAVFDGHAG--- 68
            ||.| .|.||..|     :.|:.     |.|.  |:.....|  .:.|.|..|:|:||||.|   
Human    80 EKSEFNEDQAACG-----KLCIR-----RCEFGAEEEWLTLC--PEEFLTGHYWALFDGHGGPAA 132

  Fly    69 ---SQISLH-CAEHLMSTILES----------------ESFSKHKYEAGIR----------EGFL 103
               :..:|| |....:..::|.                .|..:...|.|||          ..|.
Human   133 AILAANTLHSCLRRQLEAVVEGLVATQPPMHLNGRCICPSDPQFVEEKGIRAEDLVIGALESAFQ 197

  Fly   104 QLDEDM-RKL-YHDQQGGSTAICVFVSPDKIYLVNCGDSRAVISRNGAAVISTIDHKP----FSP 162
            :.||.: |:| ...|.||.||:.......|:|:.|.|||||::.|..       :.:|    |:|
Human   198 ECDEVIGRELEASGQMGGCTALVAVSLQGKLYMANAGDSRAILVRRD-------EIRPLSFEFTP 255

  Fly   163 K-EQERIQ--------------------------NAGGSVMIK---------------------- 178
            : |::|||                          :.|..|:.:                      
Human   256 ETERQRIQQLAFVYPELLAGEFTRLEFPRRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKYPLI 320

  Fly   179 -------RINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPDIIVCN----RSEHDEFIVVACDG 232
                   |:.|||||||..||:..:...:...:...:...|.:.|.:    ..:.|:.:|:|.||
Human   321 HGQGRQARLLGTLAVSRGLGDHQLRVLDTNIQLKPFLLSVPQVTVLDVDQLELQEDDVVVMATDG 385

  Fly   233 IWDVMTSSEVCEFIRSRLLVTYDLPMIVNSVLDICLH--KGSRDNMT 277
            :|||:::.:|...:||.|....:.|...:.:..:.:|  :|..|::|
Human   386 LWDVLSNEQVAWLVRSFLPGNQEDPHRFSKLAQMLIHSTQGKEDSLT 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 79/352 (22%)
PP2C_C 284..352 CDD:285117
PPM1MNP_653242.3 PP2Cc 118..449 CDD:238083 73/322 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144739
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.