Sequence 1: | NP_651472.2 | Gene: | CG6036 / 43185 | FlyBaseID: | FBgn0039421 | Length: | 371 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_775625.1 | Gene: | Pp2d1 / 110332 | MGIID: | 3612067 | Length: | 620 | Species: | Mus musculus |
Alignment Length: | 312 | Identity: | 61/312 - (19%) |
---|---|---|---|
Similarity: | 110/312 - (35%) | Gaps: | 102/312 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 GLRYCVSSMQGWRLEMEDSHSAACRLKDPFATWSYFAVFDGHAG----------------SQISL 73
Fly 74 HCAEHLMS-----------TILESE-------------SF--SKHKYE---AGIREGFLQLD--- 106
Fly 107 --------------------------------EDMRKLYHDQQGGSTAICVFVSPDKI----YLV 135
Fly 136 NCGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVM----IKRINGTLAVSRAFGDY-DF 195
Fly 196 KNDGSKSPVDQMVS-PEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFI 246 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6036 | NP_651472.2 | PP2Cc | 27..277 | CDD:238083 | 60/310 (19%) |
PP2C_C | 284..352 | CDD:285117 | |||
Pp2d1 | NP_775625.1 | PP2Cc | 187..472 | CDD:238083 | 58/296 (20%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167834871 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0631 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |