DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and ppm1d

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_002933883.2 Gene:ppm1d / 100489786 XenbaseID:XB-GENE-1011380 Length:551 Species:Xenopus tropicalis


Alignment Length:286 Identity:85/286 - (29%)
Similarity:135/286 - (47%) Gaps:73/286 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EKPETEKQAQEGHGNGLRYCVSSMQGWRLEMEDSHSAACRLKDPFATWSYFAVFDGHAGSQISLH 74
            ::|.:|:  :||.|...|.|       |.|...|.:...:      |.::|||:|||.|.:.:..
 Frog    37 DQPWSEE--EEGAGTPGRNC-------RRERSSSPTGGRQ------TVAFFAVYDGHGGREAAHF 86

  Fly    75 CAEHLMSTILESESFSKHKYE---AGIREGFLQLDEDMRKLYHD---------QQGGSTAICVFV 127
            ..:||...|.:.:.|.....|   |.||:||:.....|.|...:         ...|:||..|.:
 Frog    87 ARDHLWGYITKQKGFMSRDPEEVCAAIRKGFVACHHAMWKKLPEWPKTMTGLPSTSGTTASVVII 151

  Fly   128 SPDKIYLVNCGDSRAVIS-RNGA-----AVISTIDHKPFSPKEQERIQNAGGSVM----IKRI-- 180
            ..:|:|:.:.|||..|.. :||:     ||..|.||||..|:|:|||:..||||:    :.|:  
 Frog   152 RGNKMYVAHVGDSGVVFGLQNGSRDSLKAVEVTQDHKPELPRERERIEGLGGSVINKSGVNRVVW 216

  Fly   181 -------NGT------------LAVSRAFGD---YDFKNDGSKSPVDQMVSPEPDIIV--CNRSE 221
                   ||.            |||:||.||   |||.:.      :.:||||||..|  .:..:
 Frog   217 KRPRLTHNGPVRRSTVFDQIPFLAVARALGDLWSYDFYSG------EFVVSPEPDTSVHTIDPQK 275

  Fly   222 HDEFIVVACDGIWDVMTSSE---VCE 244
            | :||::..||:|:::::.:   :|:
 Frog   276 H-KFIIIGSDGLWNMVSAQDAISMCQ 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 80/269 (30%)
PP2C_C 284..352 CDD:285117
ppm1dXP_002933883.2 PP2Cc 8..344 CDD:238083 85/286 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.