DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and ppm1k

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_002938669.1 Gene:ppm1k / 100487567 XenbaseID:XB-GENE-956545 Length:374 Species:Xenopus tropicalis


Alignment Length:263 Identity:78/263 - (29%)
Similarity:121/263 - (46%) Gaps:28/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SSMQGWRLEMEDSHSAACRLKDPFATWSYFAVFDGHAGSQISLHCAEHLMSTILESESFSKHKYE 95
            |:..|.|.|.||....|....|..    ||||:|||.|:..:..| :..|...::.....:|..|
 Frog   100 STQLGKRKENEDRFKLARLTPDVL----YFAVYDGHGGASAAEFC-DRFMEDYIKEFLVEEHDME 159

  Fly    96 AGIREGFLQLDEDMRKLYHDQQGGSTAIC-----VFVSPDKIYLV--NCGDSRAVISRNGAAVIS 153
            ..:.:.||:.|:...:..|.....|...|     |.:..|.|.||  :.|||||::.|.|..|..
 Frog   160 KVLVKAFLETDKAFARHAHLSVNASLLTCGTTATVALLRDGIELVVASVGDSRALLCRRGKPVKL 224

  Fly   154 TIDHKPFSPKEQERIQNAGG-----SVMIKRINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPD 213
            ||||.|...:|:.||:.:||     |:....:||.||::|:.||.|.|..|      .:..||..
 Frog   225 TIDHTPERKEEKLRIRESGGFVTWNSLGQPHVNGRLAMTRSIGDLDLKTMG------VIAEPETK 283

  Fly   214 IIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDLPMIVNSVLDICLHKGSRDNMTL 278
            .|....:: |.|:|:..|||..::.|.|:|:.|..    .:|.......:.:..:..|:.||.|.
 Frog   284 RIKLQHAD-DGFLVLTTDGINFIVNSQEICDIINQ----CHDPKEAAQVLTEQAIQYGTEDNSTA 343

  Fly   279 LLL 281
            :::
 Frog   344 IVV 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 77/257 (30%)
PP2C_C 284..352 CDD:285117
ppm1kXP_002938669.1 PP2Cc 96..348 CDD:238083 78/263 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.