DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6036 and ilkap

DIOPT Version :9

Sequence 1:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001082973.2 Gene:ilkap / 100037350 ZFINID:ZDB-GENE-070410-122 Length:345 Species:Danio rerio


Alignment Length:320 Identity:100/320 - (31%)
Similarity:153/320 - (47%) Gaps:69/320 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EKPETEKQAQEGHGNGLRYCVSSMQGWRLEMEDSH------SAACRLKDPFATWSYFAVFDGHAG 68
            :|.|.:|..:||... |...||:.:|.|.||:|:|      :..| |....:..:||||||||.|
Zfish    42 DKQEEKKVCKEGFAK-LTGFVSARRGEREEMQDAHVLLPDLNITC-LPSQVSRLAYFAVFDGHGG 104

  Fly    69 SQISLHCAEHLMSTILESESFSKHKYE-------AGIREGFLQLDEDMRKLYHDQ----QGGSTA 122
            ::.|...||:|..|:|  ..|.|...|       ..:.:.|.|.|||..|....|    :.||||
Zfish   105 ARASQFAAENLHHTLL--SKFPKGDVENLDKLVRKCLLDTFRQTDEDFLKKASSQKPAWKDGSTA 167

  Fly   123 ICVFVSPDKIYLVNCGDSRAVISR------NGAAVISTI----DHKPFSPKEQERIQNAGGSVMI 177
            .|:....|.:|:.|.||||||:.|      :|.....|:    :|.|...:|:.|||.|||:|..
Zfish   168 TCLLAVDDVLYVANLGDSRAVLCRMEQAKDSGKRKCVTLALSKEHNPTIYEERMRIQRAGGTVRD 232

  Fly   178 KRINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEV 242
            .|:.|.|.|||:.||..:|..|        |...||:..|..|.:|:|:::||||::.|.::.|.
Zfish   233 GRVLGVLEVSRSIGDGQYKRCG--------VISTPDLRRCQLSPNDKFVLLACDGLFKVFSADEA 289

  Fly   243 CEFIRSRLLVTYDLPMIVNSVLDI---------------------CLHKGSRDNMTLLLL 281
            .:|:         |.::.|..:::                     .:.:||.||:|::|:
Zfish   290 VQFV---------LGVLENETVELKEGQSEGAGLFEAACQRLASEAVRRGSADNVTVILV 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 92/297 (31%)
PP2C_C 284..352 CDD:285117
ilkapNP_001082973.2 PP2Cc 59..342 CDD:238083 94/302 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.