DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6154 and DPEP3

DIOPT Version :9

Sequence 1:NP_651471.2 Gene:CG6154 / 43184 FlyBaseID:FBgn0039420 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001357127.1 Gene:DPEP3 / 64180 HGNCID:23029 Length:488 Species:Homo sapiens


Alignment Length:395 Identity:176/395 - (44%)
Similarity:240/395 - (60%) Gaps:25/395 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PILRCSAGAASSASGGG---SKTADDFDFRMQRVRNVLKEVPLIDGHNDLPWNIRKFLKNQLKDF 89
            |.|..:.|..|:.:..|   ..|....|.| .|.:.:::..||:|||||||..:|:..||.|:|.
Human    52 PSLFTTPGVPSALTTPGLTTPGTPKTLDLR-GRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDV 115

  Fly    90 HFGGDLRELAPWSSSAWSH--TDLRRLKEGMVSAQFWSAYAPCSSQHLDAVQLTLEQIDLIRRLV 152
                :||.        :||  |.|.||::|:|.||||||...|.||...||:|.|||||||.|:.
Human   116 ----NLRN--------FSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMC 168

  Fly   153 QLYPHHMALVTTASGIEQTHRTGKIASLIGVEGGHAIGTSLSVLRMFYQLGARYLTLTHTCNTPW 217
            ..| ..:.|||:|.|:..:.   |:|.||||||||::.:||||||.||.||.||||||.||:|||
Human   169 ASY-SELELVTSAEGLNSSQ---KLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPW 229

  Fly   218 ADCCKVDEPGKYPHIGGLSQFGKLVVKEMNRLGMIVDLSHVSVPTMLDALAASRAPLIFSHSSAH 282
            |:.........|.::.||:.||:.||:|:|||||::|||:.|...:...|..|:||:|||||:|.
Human   230 AESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAAR 294

  Fly   283 AICNSSRNVPDHVLQRIAINGGLVMVAFYPHFVSCSGQATLHDVVAHINHIREVAGIDHVGIGAG 347
            |:|::..||||.:||.:..|||:|||......:.|:..|.:..|..|.:|||.|.|.:.:|||..
Human   295 AVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGN 359

  Fly   348 YDGVNLVPKGLEDVSKYPHLFAALLESDKWSEEDIAKLAGRNLIRVFKEVEAVRDQMELLRVAPI 412
            |||....|:||||||.||.|...|| |..||||::..:...||:|||::||.||:  |....:|:
Human   360 YDGTGRFPQGLEDVSTYPVLIEELL-SRSWSEEELQGVLRGNLLRVFRQVEKVRE--ESRAQSPV 421

  Fly   413 DQSIP 417
            :...|
Human   422 EAEFP 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6154NP_651471.2 Peptidase_M19 61..396 CDD:395996 160/336 (48%)
DPEP3NP_001357127.1 Peptidase_M19 87..407 CDD:395996 160/336 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155228
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2355
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53057
OrthoDB 1 1.010 - - D1272387at2759
OrthoFinder 1 1.000 - - FOG0001225
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102004
Panther 1 1.100 - - O PTHR10443
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X677
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.720

Return to query results.
Submit another query.