DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6154 and CG44837

DIOPT Version :9

Sequence 1:NP_651471.2 Gene:CG6154 / 43184 FlyBaseID:FBgn0039420 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001287037.1 Gene:CG44837 / 5740513 FlyBaseID:FBgn0266100 Length:964 Species:Drosophila melanogaster


Alignment Length:376 Identity:199/376 - (52%)
Similarity:259/376 - (68%) Gaps:11/376 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RMQRVRNVLKEVPLIDGHNDLPWNIRKFLKNQLKDFHFGGDLRELAPWSSSAWSHTDLRRLKEGM 118
            |::.||.:|:||||:||||:..||:||:..:.| :.|...|:...:.||..||:.||:.|||:|:
  Fly   597 RLRIVRRILREVPLVDGHNNYAWNVRKYAHSSL-ELHLSHDVDHKSLWSRPAWAQTDMERLKQGL 660

  Fly   119 VSAQFWSAYAPCSSQHLDAVQLTLEQIDLIRRLVQLYPHHMALVTTASGIEQTHRTGKIASLIGV 183
            ||.|.||||.||.:|.||||||.|||||::|||..:|.....|.|::..|...||.|.:||||||
  Fly   661 VSVQVWSAYVPCEAQGLDAVQLALEQIDIVRRLSDMYARETVLATSSQDIVDAHRRGLLASLIGV 725

  Fly   184 EGGHAIGTSLSVLRMFYQLGARYLTLTHTCNTPWADCCKVDEPGKYPHIGGLSQFGKLVVKEMNR 248
            ||||.||:||.|||.||.||||||:|||.|:..||.      ....|...||:.|||.:|:||||
  Fly   726 EGGHTIGSSLGVLRSFYSLGARYLSLTHRCDVSWAG------SSASPAEQGLTPFGKAIVREMNR 784

  Fly   249 LGMIVDLSHVSVPTMLDALAASRAPLIFSHSSAHAICNSSRNVPDHVLQRIAINGGLVMVAFYPH 313
            |||::||||.|..|..|.|..:|||:|||||:|..:|||:|||||.:|:.:|.||||:|::|...
  Fly   785 LGMMIDLSHSSDATARDVLQVTRAPVIFSHSAARQLCNSTRNVPDDILRLVAENGGLIMLSFDSE 849

  Fly   314 FVSCSGQATLHDVVAHINHIREVAGIDHVGIGAGYDGVNLVPKGLEDVSKYPHLFAALLESDKWS 378
            .|:|..||.|.||:.||.::|.:|||.|:|:||||||:.|.|.|||||||||.|.|||||...||
  Fly   850 DVACGRQARLQDVIEHIKYVRAIAGIQHIGLGAGYDGIELPPLGLEDVSKYPELLAALLEDHNWS 914

  Fly   379 EEDIAKLAGRNLIRVFKEVEAVRDQMELLRVAPIDQSIPAEDIMGRSYCRY 429
            |||:|.|||||.:|:.:.||.|||..:...:.||:|:.|    ..::.|.|
  Fly   915 EEDVAMLAGRNFLRIMETVETVRDYWKRAAIQPIEQTEP----QPKTQCTY 961

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6154NP_651471.2 Peptidase_M19 61..396 CDD:395996 185/334 (55%)
CG44837NP_001287037.1 rDP_like 609..929 CDD:238626 181/326 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466849
Domainoid 1 1.000 347 1.000 Domainoid score I1002
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1272387at2759
OrthoFinder 1 1.000 - - FOG0001225
OrthoInspector 1 1.000 - - otm26602
orthoMCL 1 0.900 - - OOG6_102004
Panther 1 1.100 - - P PTHR10443
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.