DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6154 and Dpep2

DIOPT Version :9

Sequence 1:NP_651471.2 Gene:CG6154 / 43184 FlyBaseID:FBgn0039420 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_006531144.1 Gene:Dpep2 / 319446 MGIID:2442042 Length:611 Species:Mus musculus


Alignment Length:438 Identity:192/438 - (43%)
Similarity:263/438 - (60%) Gaps:44/438 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KGFVLCGLNCLTFVYFPLVL----PILRCS-----AGAASSASGGGSKTADDF------------ 51
            ||..:.|.....|:...|:|    |::...     :||::::|...:.|..|.            
Mouse   140 KGHWVLGHGLSVFLLVLLLLGPSQPLIWTQTKPGFSGASTTSSIPRALTKPDISSIPTTPGNPNF 204

  Fly    52 -DFRMQRVRNVLKEVPLIDGHNDLPWNIRKFLKNQLKDFHFGGDLRELAPWSSSAWSH--TDLRR 113
             |.| .|.|.:::|.||||||||:|..:|:|.:|.|:|    .:||.        ::|  |.|.|
Mouse   205 PDLR-DRARALMQEFPLIDGHNDMPLVLRQFYQNGLQD----ANLRN--------FTHGQTSLDR 256

  Fly   114 LKEGMVSAQFWSAYAPCSSQHLDAVQLTLEQIDLIRRLVQLYPHHMALVTTASGIEQTHRTGKIA 178
            ||:|:|.|||||||.||.:|..||::|||||||||||:...| ..:.|||:...:..|.   |:|
Mouse   257 LKDGLVGAQFWSAYVPCQTQDRDALRLTLEQIDLIRRICASY-SELELVTSVKALNSTQ---KLA 317

  Fly   179 SLIGVEGGHAIGTSLSVLRMFYQLGARYLTLTHTCNTPWADCCKVDEPGKYPHIGGLSQFGKLVV 243
            .||||||||::..||:|||.||.||.||||||||||||||:.........|..:.||:.||:.||
Mouse   318 CLIGVEGGHSLDNSLAVLRSFYLLGVRYLTLTHTCNTPWAETSSKGVHAFYSSVTGLTSFGEKVV 382

  Fly   244 KEMNRLGMIVDLSHVSVPTMLDALAASRAPLIFSHSSAHAICNSSRNVPDHVLQRIAINGGLVMV 308
            .|||||||:|||||||......||..|:||:|||||:|.|:|.::||:||.:||.:..|||:|||
Mouse   383 AEMNRLGMMVDLSHVSDAAARRALEVSQAPVIFSHSAARAVCPNARNLPDDLLQLLKKNGGIVMV 447

  Fly   309 AFYPHFVSCSGQATLHDVVAHINHIREVAGIDHVGIGAGYDGVNLVPKGLEDVSKYPHLFAALLE 373
            .|....:.|:..|.:..|..|.:|||.|.|.:.:|||..|||....|:||||||.||.|...||.
Mouse   448 TFSVGVLPCNPLANVSTVADHFDHIRSVIGSEFIGIGGDYDGTKQFPQGLEDVSTYPVLIEELLR 512

  Fly   374 SDKWSEEDIAKLAGRNLIRVFKEVEAVRDQMELLRVAPIDQSIPAEDI 421
            .. |:|:::..:...||:|||::||.|||:.:.  .:|::..||.|.:
Mouse   513 RG-WNEQELQGILRGNLLRVFRQVEQVRDKSKW--QSPLEDMIPEEQL 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6154NP_651471.2 Peptidase_M19 61..396 CDD:395996 167/336 (50%)
Dpep2XP_006531144.1 Peptidase_M19 213..534 CDD:366534 167/337 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845704
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2355
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53057
OrthoDB 1 1.010 - - D1272387at2759
OrthoFinder 1 1.000 - - FOG0001225
OrthoInspector 1 1.000 - - mtm8896
orthoMCL 1 0.900 - - OOG6_102004
Panther 1 1.100 - - O PTHR10443
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X677
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.720

Return to query results.
Submit another query.