DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ald1 and PDE345

DIOPT Version :9

Sequence 1:NP_001262985.1 Gene:Ald1 / 43183 FlyBaseID:FBgn0000064 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_178224.1 Gene:PDE345 / 814643 AraportID:AT2G01140 Length:391 Species:Arabidopsis thaliana


Alignment Length:330 Identity:181/330 - (54%)
Similarity:223/330 - (67%) Gaps:5/330 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAENISGVI 78
            |||.:.|:.|.:||:||||.|||..|.||||..||::||||||:||||||.:| |.|.:.|||.|
plant    46 DELVKTAKSIASPGRGILAIDESNATCGKRLASIGLDNTEDNRQAYRQLLLTT-PGLGDYISGSI 109

  Fly    79 LFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGC 143
            ||.|||||...||..|.:.|:...|:.|||||||:.||.||.:|...||||.||:|.|:|.|.|.
plant   110 LFEETLYQSTKDGKTFVDCLRDANIVPGIKVDKGLSPLAGSNEESWCQGLDGLASRSAEYYKQGA 174

  Fly   144 DFAKWRCVLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLDRAQKVTET 208
            .|||||.|:.:... ||..::.|.|..|||||:|.|...:|||||||:|.||||.::|..:|.|.
plant   175 RFAKWRTVVSVPCG-PSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEK 238

  Fly   209 VLAAVYKALSDHHVYLEGTLLKPNMVTAGQSAK-KNTPEEIALATVQALRRTVPAAVTGVTFLSG 272
            |.:.|:..|:.::|..||.||||:|||.|...| |.:||.:|..|:..|:|.||.||.|:.||||
plant   239 VWSEVFFYLAQNNVMFEGILLKPSMVTPGAEHKNKASPETVADFTLTMLKRRVPPAVPGIMFLSG 303

  Fly   273 GQSEEEATVNLSAINNVPLIRPWALTFSYGRALQASVLRAWAGKKENIAAGQNELLKRAKANSQA 337
            ||||.|||:||:|:|..|  .||.::|||.||||.||||.|.||.|.|.|.|..||.||||||.|
plant   304 GQSEAEATLNLNAMNQSP--NPWHVSFSYARALQNSVLRTWQGKPEKIEASQKALLVRAKANSLA 366

  Fly   338 CQGIY 342
            ..|.|
plant   367 QLGKY 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ald1NP_001262985.1 Glycolytic 15..363 CDD:278692 180/329 (55%)
PDE345NP_178224.1 PLN02425 1..391 CDD:215234 181/330 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3588
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63159
OrthoDB 1 1.010 - - D799973at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100527
Panther 1 1.100 - - O PTHR11627
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.790

Return to query results.
Submit another query.