DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ald1 and aldob

DIOPT Version :9

Sequence 1:NP_001262985.1 Gene:Ald1 / 43183 FlyBaseID:FBgn0000064 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_989131.1 Gene:aldob / 394736 XenbaseID:XB-GENE-5925393 Length:364 Species:Xenopus tropicalis


Alignment Length:364 Identity:232/364 - (63%)
Similarity:270/364 - (74%) Gaps:1/364 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFS 65
            |...|...:.|.:.||.||||:||||||||||||||..|||.||:.|.|||.|:|||.||:|||:
 Frog     1 MAPVFPALTAEQKKELSEIAQRIVAPGKGILAADESVGTMGSRLKRINVENIEENRRLYRELLFT 65

  Fly    66 TDPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDD 130
            .||.:.::|.||||||||||||:.||..|.:|||..||::|||||||..||.|::.|.||||||.
 Frog    66 ADPSIKDSIGGVILFHETLYQKSRDGVLFPKILKDLGIVVGIKVDKGTAPLAGTDGETTTQGLDG 130

  Fly   131 LAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDG 195
            ||.|||||||||.|||||||||||..:.||..:|.||||||||||||||...:|||||||:|.||
 Frog   131 LAERCAQYKKDGADFAKWRCVLKISDSAPSSLAIYENANVLARYASICQQNGLVPIVEPEILSDG 195

  Fly   196 DHDLDRAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAGQS-AKKNTPEEIALATVQALRRT 259
            .|||.|.|..||.||:|||.||..||||||||||||||||.||| ::|.||:::|:|||.|||||
 Frog   196 SHDLQRCQYETEKVLSAVYAALIQHHVYLEGTLLKPNMVTGGQSCSQKYTPQDVAMATVTALRRT 260

  Fly   260 VPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFSYGRALQASVLRAWAGKKENIAAGQ 324
            ||.||.|:.|||||||||||::||:|:|...|.|||.::||||||||||.|.||.||.||..|.|
 Frog   261 VPPAVPGICFLSGGQSEEEASLNLNAMNCCSLNRPWRVSFSYGRALQASALSAWVGKSENEKAAQ 325

  Fly   325 NELLKRAKANSQACQGIYVPGSIPSFAGNANLFVAQHKY 363
            ...:||||.|..|..|.|||......|.:.:||...:.|
 Frog   326 EAFVKRAKINGLATLGKYVPSGSSDSASSQSLFQPSYTY 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ald1NP_001262985.1 Glycolytic 15..363 CDD:278692 228/348 (66%)
aldobNP_989131.1 Glycolytic 15..364 CDD:365995 228/348 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 490 1.000 Domainoid score I379
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 491 1.000 Inparanoid score I1381
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D342837at33208
OrthoFinder 1 1.000 - - FOG0000633
OrthoInspector 1 1.000 - - mtm9528
Panther 1 1.100 - - LDO PTHR11627
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X377
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.