DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ald1 and ALDOB

DIOPT Version :9

Sequence 1:NP_001262985.1 Gene:Ald1 / 43183 FlyBaseID:FBgn0000064 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_000026.2 Gene:ALDOB / 229 HGNCID:417 Length:364 Species:Homo sapiens


Alignment Length:356 Identity:228/356 - (64%)
Similarity:265/356 - (74%) Gaps:1/356 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAEN 73
            ::|.:.||.||||.|||.||||||||||..|||.|||.|.|||||:|||.:|::|||.|..:.::
Human     9 TQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSINQS 73

  Fly    74 ISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQY 138
            |.||||||||||||...|..|..|||:|||::|||:|:|..||.|:..|.|.||||.|:.|||||
Human    74 IGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQY 138

  Fly   139 KKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLDRAQ 203
            ||||.||.|||.||:|....||..:|.||||.|||||||||...:||||||||:|||||||:..|
Human   139 KKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYASICQQNGLVPIVEPEVIPDGDHDLEHCQ 203

  Fly   204 KVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAGQS-AKKNTPEEIALATVQALRRTVPAAVTGV 267
            .|||.|||||||||:|||||||||||||||||||.: .||.|||::|:|||.||.|||||||.|:
Human   204 YVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGI 268

  Fly   268 TFLSGGQSEEEATVNLSAINNVPLIRPWALTFSYGRALQASVLRAWAGKKENIAAGQNELLKRAK 332
            .|||||.|||:||:||:|||..||.:||.|:||||||||||.|.||.||..|..|.|...:|||.
Human   269 CFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQEAFMKRAM 333

  Fly   333 ANSQACQGIYVPGSIPSFAGNANLFVAQHKY 363
            ||.||.:|.||.......|...:||.|.:.|
Human   334 ANCQAAKGQYVHTGSSGAASTQSLFTACYTY 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ald1NP_001262985.1 Glycolytic 15..363 CDD:278692 226/348 (65%)
ALDOBNP_000026.2 Glycolytic 15..364 CDD:278692 226/348 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160138
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 498 1.000 Inparanoid score I1383
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63159
OrthoDB 1 1.010 - - D342837at33208
OrthoFinder 1 1.000 - - FOG0000633
OrthoInspector 1 1.000 - - mtm8632
orthoMCL 1 0.900 - - OOG6_100527
Panther 1 1.100 - - LDO PTHR11627
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X377
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.