DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ald1 and LOC112694756

DIOPT Version :9

Sequence 1:NP_001262985.1 Gene:Ald1 / 43183 FlyBaseID:FBgn0000064 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001352233.1 Gene:LOC112694756 / 112694756 -ID:- Length:139 Species:Homo sapiens


Alignment Length:35 Identity:9/35 - (25%)
Similarity:13/35 - (37%) Gaps:8/35 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 DLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSI 164
            |.|.||.:.    |......|..::    |..||:
Human   103 DWAPRCPRC----CPLCDCACTCQL----PDCQSL 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ald1NP_001262985.1 Glycolytic 15..363 CDD:278692 9/35 (26%)
LOC112694756NP_001352233.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.