DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and Prss36

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:308 Identity:70/308 - (22%)
Similarity:115/308 - (37%) Gaps:92/308 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RVWGGVQSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANC------------------I 85
            |:.||  |:..|....|.:.:..|.|:. ||.:..||..|:::|:|                  :
Mouse    47 RIVGG--SDAHPGTWPWQVSLHQGGGHI-CGGSLIAPSWVLSAAHCFVTNGTLEPADELSVLLGV 108

  Fly    86 YPYRNSLEGATVEGTAFSECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFIRL 150
            :.....||||.:...|             ||..|:.:...:|..|:|::||..|           
Mouse   109 HSQDGPLEGAHMRSVA-------------TILIPDNYSTVELGADLALLRLASP----------- 149

  Fly   151 CSVKVQPKMQMVVF----------------GWGFDNTEVEIPSSDP---RNVTVTIISIKECRQK 196
              .|:.|.::.|..                |||  :.:..:|...|   :.|.:.::....|:..
Mouse   150 --AKLGPSVRPVCLPRASHLFAHGTACWATGWG--DVQEAVPLPLPWVLQEVELRLLGEAACQCL 210

  Fly   197 FKSP-------KIASTSICARQPKNPKQ-CLYDGGSPLIY---GR-ELCGVVSFGSHCIDTSRPG 249
            :..|       ::....:||..|...:. |..|.|.||:.   || .|.|:.|||..|...:|||
Mouse   211 YSRPGPFNLTFQLLPGMLCAGYPAGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPG 275

  Fly   250 MYTNIRRVKRFITETEESINAGDVFRSTKVVKETKKPPKKTIKPKSKP 297
            ::|.:...:.:|.|.......|.||            |.:..||:|.|
Mouse   276 VFTAVAPYESWIREHVMGSEPGPVF------------PSQLQKPQSGP 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 60/270 (22%)
Tryp_SPc 55..261 CDD:304450 55/254 (22%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 60/272 (22%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.