DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and Prss55

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_008769022.1 Gene:Prss55 / 683415 RGDID:1586875 Length:321 Species:Rattus norvegicus


Alignment Length:280 Identity:71/280 - (25%)
Similarity:117/280 - (41%) Gaps:59/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RVWGGVQSNTG--PNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTA 101
            |:.||.::..|  |    |.:.|...|.:| ||.:..:...::|.|:|.|....|....||    
  Rat    34 RIIGGQEAEVGEFP----WQVSIQENDHHF-CGGSILSEWWILTVAHCFYSQELSPTELTV---- 89

  Fly   102 FSECDRENYADIDT---------IQFPEKFIYQKLYMDVAVVRLRDPVRGRLT---EFIRLCSVK 154
                 |....|:.|         |...:.|....:..|:|::.|.:|    ||   :.:.:| :.
  Rat    90 -----RVGTNDLTTSPMELQVTNIIRHKDFKRHSMDNDIALLLLANP----LTFNEQTVPIC-MP 144

  Fly   155 VQPK----MQMVVFGWGFDNT-EVEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSICARQPKN 214
            :||.    .:..|.|||..|: :.|..:.|...|.:.|...|||.|.|  |.:.:..:||.....
  Rat   145 LQPTPPSWQECWVAGWGTTNSADKESMNMDLMKVPMRITDWKECLQLF--PSLTTNMLCASYGNE 207

  Fly   215 P-KQCLYDGGSPLIYGRE------LCGVVSFGSHCIDTSRPGMYTNIRR----VKRFITETEE-- 266
            . ..|..|.|.||:..:|      ..|::|:|..|.....||:||.:..    ::: ||:.|.  
  Rat   208 SFDACQGDSGGPLVCNQESDGRWYQVGIISWGKSCGQKGSPGIYTVLANYILWIEK-ITQIEGKP 271

  Fly   267 -SINAGDVFRSTKVVKETKK 285
             .:|:    :...|.|:|:|
  Rat   272 LDLNS----QMVSVKKKTRK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 63/251 (25%)
Tryp_SPc 55..261 CDD:304450 58/233 (25%)
Prss55XP_008769022.1 Tryp_SPc 35..264 CDD:238113 62/250 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.