DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:230 Identity:54/230 - (23%)
Similarity:95/230 - (41%) Gaps:53/230 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFSECDRENYADIDTIQFPEKFI- 123
            ||...:| ||.:......|:::|:|   |::.::            .|....:||.::..|:|| 
Mouse    42 LNSGYHF-CGGSLINSQWVVSAAHC---YKSRIQ------------VRLGEHNIDALEGGEQFID 90

  Fly   124 --------------YQKLYMDVAVVRLRDPVRGRLTEFIRLCSVKVQPK------MQMVVFGWGF 168
                          |..   |:.:::|:...    |...|:.:|.: |:      .:.:|.||| 
Mouse    91 AAKIIRHPNYNANTYNN---DIMLIKLKTAA----TLNSRVSTVAL-PRSCPSAGTRCLVSGWG- 146

  Fly   169 DNT---EVEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSICARQPKNPK-QCLYDGGSPLIYG 229
             ||   ....||. .:.:...::|...|...:.. ||.|...|....:..| .|..|.|.|::..
Mouse   147 -NTLSSGTNYPSL-LQCLDAPVLSDSSCTSSYPG-KITSNMFCLGFLEGGKDSCQGDSGGPVVCN 208

  Fly   230 RELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITET 264
            .:|.||||:|..|....:||:||.:.:...:|.:|
Mouse   209 GQLQGVVSWGYGCAQRGKPGVYTKVCKYVNWIQQT 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 52/225 (23%)
Tryp_SPc 55..261 CDD:304450 52/225 (23%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 52/225 (23%)
Tryp_SPc 25..243 CDD:238113 53/228 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.