DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and Tmprss11d

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001028824.2 Gene:Tmprss11d / 64565 RGDID:620654 Length:417 Species:Rattus norvegicus


Alignment Length:264 Identity:62/264 - (23%)
Similarity:98/264 - (37%) Gaps:74/264 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RVWGGVQSNTGPNFGGWLLRI-LNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTA- 101
            |:.||.|:.|    |.|..:: |..:....||....:.|.|:|:|:|...|.|..:.....|.: 
  Rat   185 RIIGGTQAET----GDWPWQVSLQLNNVHHCGGTLISNLWVLTAAHCFRSYSNPQQWTATFGVST 245

  Fly   102 -----------------FSECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFI- 148
                             ::...|:|                    |:|||:|..||  ..|..| 
  Rat   246 ISPRLRVRVRAILAHAEYNSITRDN--------------------DIAVVQLDRPV--TFTRNIH 288

  Fly   149 RLC----SVKVQPKMQMVVFGWGF----DNTEVEIPSSDPRNVTVTIISIKECRQKFKSP----- 200
            |:|    :..:.|.....|.|||.    .||...:...:     |.|:|.:.|.:    |     
  Rat   289 RVCLPAATQNIIPDSVAYVTGWGSLTYGGNTVTNLQQGE-----VRIVSSEVCNE----PAGYGG 344

  Fly   201 KIASTSICARQPKNP-KQCLYDGGSPLIY--GREL---CGVVSFGSHCIDTSRPGMYTNIRRVKR 259
            .:....:||...... ..|..|.|.||:.  .|.|   .|:||:|..|...::||:||.:...:.
  Rat   345 SVLPGMLCAGVRSGAVDACQGDSGGPLVQEDTRRLWFVVGIVSWGYQCGLPNKPGVYTRVTAYRN 409

  Fly   260 FITE 263
            :|.:
  Rat   410 WIRQ 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 61/260 (23%)
Tryp_SPc 55..261 CDD:304450 55/244 (23%)
Tmprss11dNP_001028824.2 SEA 48..150 CDD:396113
Tryp_SPc 186..414 CDD:238113 61/263 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.