DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and Klk13

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001034131.2 Gene:Klk13 / 626834 MGIID:3615275 Length:276 Species:Mus musculus


Alignment Length:311 Identity:77/311 - (24%)
Similarity:128/311 - (41%) Gaps:70/311 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IWLLVSCLLWTCLPQSQGTVYPRDILLKTPKFRRVWGGVQSNTG---------PNFGGW----LL 57
            :|.||:.:....|..|:|  ..||       :.::..|....:|         |:...|    |:
Mouse     1 MWPLVATIACLTLALSEG--ISRD-------YPKILNGTNGTSGFLPGGYTCLPHSQPWQAALLI 56

  Fly    58 RILNGDGNFACGAAYYAPLLVITSANC------IYPYRNSLEGATVEGTAFSECDRENYADIDTI 116
            |     |...||.....|..|:|:|:|      ::..:::| |....|....|..|       :|
Mouse    57 R-----GRLLCGGVLVHPKWVLTAAHCRKDGYTVHLGKHAL-GRVENGEQAMEVVR-------SI 108

  Fly   117 QFPEKFIYQKLYM------DVAVVRLRDPVRGRLTEFIRLCSVKVQPKMQ----MVVFGWGFDNT 171
            ..||   ||....      |:.::.|:.||  :|:..:|...:.....:.    ..|.|||...:
Mouse   109 PHPE---YQVTPTHLNHDHDIMLLELKSPV--QLSSHVRTLKLSADDCLPTGTCCRVSGWGTTTS 168

  Fly   172 -EVEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSICARQPKNPK-QCLYDGGSPLIYGRELCG 234
             :|..|.: .:...:.:.|.:||||.:.. ||.:..:||...:..| .|..|.|.|||...:|.|
Mouse   169 PQVNYPKT-LQCANIELRSDEECRQVYPG-KITANMLCAGTKEGGKDSCEGDSGGPLICNGKLYG 231

  Fly   235 VVSFGSH-CIDTSRPGMYTNIRRVKRFITETEESINAGDVFRSTKVVKETK 284
            ::|:|.. |...:|||:||.:.:..|:|.|         :.|:|...:.||
Mouse   232 IISWGDFPCGQPNRPGVYTRVSKYLRWIRE---------IIRNTPEQRWTK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 63/253 (25%)
Tryp_SPc 55..261 CDD:304450 60/228 (26%)
Klk13NP_001034131.2 Tryp_SPc 39..262 CDD:238113 63/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.