DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG17242

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:220 Identity:57/220 - (25%)
Similarity:95/220 - (43%) Gaps:38/220 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGAAYYAPLLVITSANCIYPYRNSLEGATVE-GTAFSECDRENYADIDTIQFPEKFIYQKLYM-- 129
            ||...|:..:::|.|.|:...|  ||..:|. |:|     :||..  .|:...||...|.|.:  
  Fly    41 CGGVIYSEDIILTIAECVRKAR--LEFISVRVGSA-----QENAG--GTVLKVEKMRLQVLGLRP 96

  Fly   130 -DVAVVRLRDP------VRGRLTEFIRLCSVKVQPKMQMVVFGWGFDNTEVEIPSSDPRNVTVTI 187
             |||:::||.|      :|.     |.|.::.:.|.....|.|||      ::.:.:|.:..:..
  Fly    97 SDVAILQLRSPLYLDGGIRA-----IPLATIPLVPGTNASVSGWG------QLSAMNPSSEVLLR 150

  Fly   188 ISIKECRQ-------KFKSPKIASTSICARQP-KNPKQCLYDGGSPLIYGRELCGVVSFGSHCID 244
            :.:|...|       ..|...::...|||... :.|..|....|.||:....|.|::|:.|.|..
  Fly   151 VDVKIQDQLMCATNLALKGRLMSVGEICAAPAGEIPYACQGFVGGPLVANNRLYGILSWQSACDV 215

  Fly   245 TSRPGMYTNIRRVKRFITETEESIN 269
            .::..:|.||...|.:|..|.:.:|
  Fly   216 LNKSSVYANIAMFKVWIESTVKLMN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 54/210 (26%)
Tryp_SPc 55..261 CDD:304450 54/210 (26%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 55/213 (26%)
Tryp_SPc 24..232 CDD:214473 54/210 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.