DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG17234

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:244 Identity:57/244 - (23%)
Similarity:100/244 - (40%) Gaps:46/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 WLLRILNGD----------------GNFACGAAYYAPLLVITSANCIYPYR-NSL--EGATVE-G 99
            |..||:.|:                |:..||.:.|:..:::|:|:|.:... |.|  :|..|. |
  Fly    23 WEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAG 87

  Fly   100 TAFSECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEF------IRLCSVKVQPK 158
            :|.:: ......|:..:...|::.:.....|:|:|||..|:     ||      |.|......|:
  Fly    88 SALTD-SNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPL-----EFTSKVQPIPLAKTNPYPR 146

  Fly   159 MQMVVFGWGFD---NTEVEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSICARQPKNPKQCLY 220
            ...:|.|||..   |....:..:..:.:.:.|.||..||  ...|.:.......|     ..|..
  Fly   147 SIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCR--LFDPSLLCAGTYGR-----TACHG 204

  Fly   221 DGGSPLIYGRELCGVVSFG-SHCIDTSRPGMYTNIRRVKRFITETEESI 268
            |.|.||:..::|.||||:| ..|:.::   .:.::...:.:|.....||
  Fly   205 DSGGPLVVNKQLVGVVSWGRKGCVSSA---FFVSVPYFREWILNAIASI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 54/235 (23%)
Tryp_SPc 55..261 CDD:304450 54/235 (23%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 53/232 (23%)
Tryp_SPc 27..243 CDD:238113 52/231 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.