DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG34458

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:208 Identity:52/208 - (25%)
Similarity:93/208 - (44%) Gaps:13/208 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 DGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFSECDRENYADIDTIQF--PEKFIYQ 125
            :|...||.:..:..:::|:|:|... :|..:...:.||  ::....|....:..||  ..::..|
  Fly    52 NGRHHCGGSLISDTMIVTAAHCTMG-QNPGQMKAIVGT--NDLSAGNGQTFNIAQFIIHPRYNPQ 113

  Fly   126 KLYMDVAVVRLRDPV-RGRLTEFIRLC---SVKVQPKMQMVVFGWGFDNTEVEIPSSDPRNVTVT 186
            ....|:::::|..|| .|...:.|:|.   |......|.| :.|:|..|..:::|:. .:...|.
  Fly   114 SQDFDMSLIKLSSPVPMGGAVQTIQLADSDSNYAADTMAM-ISGFGAINQNLQLPNR-LKFAQVQ 176

  Fly   187 IISIKECRQKFKSPKIASTSICARQPKNP-KQCLYDGGSPLIYGRELCGVVSFGSHCIDTSRPGM 250
            :.|...|..: ..|.:....:||..|... ..|..|.|.||....:|.||||:|..|....||.|
  Fly   177 LWSRDYCNSQ-NIPGLTDRMVCAGHPSGQVSSCQGDSGGPLTVDGKLFGVVSWGFGCGAKGRPAM 240

  Fly   251 YTNIRRVKRFITE 263
            ||.:..::.:|.:
  Fly   241 YTYVGALRSWIKQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 51/204 (25%)
Tryp_SPc 55..261 CDD:304450 51/204 (25%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 51/204 (25%)
Tryp_SPc 32..254 CDD:238113 52/208 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.