DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG34457

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster


Alignment Length:214 Identity:45/214 - (21%)
Similarity:73/214 - (34%) Gaps:47/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LVITSANCIY-----------PYRNSLEGATVEGTAFSECDRENYADIDTIQFPEKFIYQKLYMD 130
            |::..|..:|           |.:..:.||.|:....    ..|.:|:||..         |...
  Fly    47 LLVEKARTLYDNFHKEIVLAAPKQTIIFGAIVQLMPI----HINISDMDTTD---------LNAA 98

  Fly   131 VAVVRLRDPVRGRLTEFIRLCSVKVQPKMQMVVFGWGFDNTEVEIPSSDPRNVTVTIISIKECRQ 195
            ::|| :.:.|..:.......|.:.|.|..:..|      ....:|.|.|.|:.|...|   :..|
  Fly    99 LSVV-INEKVVRKSQSINEDCELSVAPSKRPCV------RNSFKIVSGDGRDRTGENI---KYGQ 153

  Fly   196 KFKSPKIASTSICARQPKNPKQCLYDGGSPLIYGRELCGVVSFG--------SHCIDTSRPGMYT 252
            :|:...:||..........||:|....|....|.....|.::..        ..|.|...|..||
  Fly   154 RFQLQCMASEHDPIVLYSGPKRCNLQQGVHATYLSHKNGELNLNLGLVHRSKLSCPDNDIPIAYT 218

  Fly   253 N-----IRRVKRFITETEE 266
            |     :...:||.:|.|:
  Fly   219 NWFCRHVNPKQRFESEGED 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 42/207 (20%)
Tryp_SPc 55..261 CDD:304450 42/207 (20%)
CG34457NP_001097339.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.