DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG34290

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster


Alignment Length:297 Identity:62/297 - (20%)
Similarity:108/297 - (36%) Gaps:89/297 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WLLVSCLLWTCLPQ----------------SQGTVYPRDILLKTPKFRRVWGGVQSNTGPNFGGW 55
            |||.|..:.:.|..                |..:.||..:.|:....|....||...        
  Fly    15 WLLHSLFIISVLESCHAVPIVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQ-------- 71

  Fly    56 LLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFSECDRENYADIDTIQFP- 119
                     :| ||.:..:...::::|:|:  :|.::...    .||  ...||..:|..:| | 
  Fly    72 ---------HF-CGGSLISDRWILSAAHCV--WRKNIHYI----AAF--IGYENIENIGQLQ-PY 117

  Fly   120 ----EKFIY---QKLYMDVAVVRLRDPVR------GRLTEFIRLCSVKVQPKM--QMVVFGWGFD 169
                .::||   .....|:|::.::   |      |...::.:|....::|..  ...:.|:|..
  Fly   118 GLESVEYIYFQPSNFRNDIALLYMK---RRYWSDFGNGLQYAQLPPHGMKPDQNESCRIIGYGAT 179

  Fly   170 N---------TEVEIPSSDPRNVTVTIISIKECRQ---KFKSPKIASTSICARQPKNPKQCLYDG 222
            :         .|.|          |.:|..::||.   ...:|:..:.::|| ...|...|..|.
  Fly   180 HHAGPCQKRLFEAE----------VRVIDNQKCRDIIGHIWAPQNGANTVCA-LGNNQDSCQGDS 233

  Fly   223 GSPLI--YGRE--LCGVVSFGSHCIDTSRPGMYTNIR 255
            |.|||  ||.:  :.|:||.|..|.....|.:||..|
  Fly   234 GGPLICTYGGKDYIYGLVSHGLTCGIPGMPSIYTVTR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 52/249 (21%)
Tryp_SPc 55..261 CDD:304450 50/233 (21%)
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 57/278 (21%)
Tryp_SPc 34..276 CDD:214473 57/278 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.