DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and AgaP_AGAP001250

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_001689374.2 Gene:AgaP_AGAP001250 / 5667664 VectorBaseID:AGAP001250 Length:279 Species:Anopheles gambiae


Alignment Length:261 Identity:64/261 - (24%)
Similarity:96/261 - (36%) Gaps:69/261 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SNTGPNFGGWLLRILNG----------------DGNFACGAAYYAPLLVITSANCIYPY------ 88
            |..|.:..|...||:.|                .|..||||:..:....:::|:|.||.      
Mosquito    41 SRGGASHDGKSARIVGGRDAPIENFPYQLSLRRSGVHACGASVISLRWALSAAHCTYPIPQMNEM 105

  Fly    89 ------RNSLEGAT-------VEGTAFSECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPV 140
                  .|.|.|.|       :....|||.         ||::           ||.|::....:
Mosquito   106 SLRAGSSNRLAGGTIIPITQIINHPLFSEY---------TIEY-----------DVCVLQTSTEM 150

  Fly   141 RGRLTEFIRL--CSVKVQPKMQMVVFGWGFDNTEVEIPSSDP---RNVTVTIISIKECRQKFKSP 200
            .|:....:.|  .:....|.......|||..|    :|.|.|   :.|.:.:||:.:||..:.|.
Mosquito   151 VGQFIVPVVLPPATSGFAPGTMANATGWGLLN----VPGSLPVQLQYVALPLISLDQCRNSWPSE 211

  Fly   201 KIASTSICARQPKNPKQCLYDGGSPLIYGRELCGVVSFG-SHCIDTSRPGMYTNIRR--VKRFIT 262
            .|....:||.|| ....|..|.|.||:......|:.|:| |.| ..:.|.::.|...  |:.||.
Mosquito   212 WITEEMLCAGQP-GRDTCGGDSGGPLVINGYQMGIASWGVSEC-SGNLPSVFANTANPTVRSFIL 274

  Fly   263 E 263
            |
Mosquito   275 E 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 61/257 (24%)
Tryp_SPc 55..261 CDD:304450 58/248 (23%)
AgaP_AGAP001250XP_001689374.2 Tryp_SPc 53..273 CDD:214473 58/245 (24%)
Tryp_SPc 54..273 CDD:238113 57/244 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.