DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and PRSS8

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:342 Identity:78/342 - (22%)
Similarity:140/342 - (40%) Gaps:66/342 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VSCLLWTCLPQS----QGTVYPRDILLKTPKFRRVWGGVQSNTGPNFGGWLLRI-LNGDGNFACG 69
            |:.||:..|.:|    :|...|..:   .|: .|:.||..:..|.    |..:: :..:|...||
Human    15 VAILLYLGLLRSGTGAEGAEAPCGV---APQ-ARITGGSSAVAGQ----WPWQVSITYEGVHVCG 71

  Fly    70 AAYYAPLLVITSANCIYPYRNSLEGATVEGTAFSECDRENYADIDTIQ--FPE-KFIYQKLYMDV 131
            .:..:...|:::|:| :|..:..|...|:..|.........|.:.|::  .|. .::.:....|:
Human    72 GSLVSEQWVLSAAHC-FPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDI 135

  Fly   132 AVVRLRDPVRGRLTEFIR-LC----SVKVQPKMQMVVFGWGFDNTEVEIPSSDP-RNVTVTIISI 190
            |:::|..|:  ..:.:|| :|    :......:...|.|||.....|.:.:..| :.:.|.:||.
Human   136 ALLQLSRPI--TFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISR 198

  Fly   191 KECR------QKFKSPK-IASTSICARQPKNPKQ-CLYDGGSPLIYGRE----LCGVVSFGSHCI 243
            :.|.      .|.:.|. :....:||...:..|. |..|.|.||....|    |.|:||:|..|.
Human   199 ETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACG 263

  Fly   244 DTSRPGMYTNIRR----VKRFITETEESINAGDVFRSTKVVKETKKPPKKTIKPKS--------- 295
            ..:|||:||....    ::..:||.:           .:||.:|::.     :|.|         
Human   264 ARNRPGVYTLASSYASWIQSKVTELQ-----------PRVVPQTQES-----QPDSNLCGSHLAF 312

  Fly   296 KPVKIQRLLRTVMVEPL 312
            .....|.|||.::..||
Human   313 SSAPAQGLLRPILFLPL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 57/247 (23%)
Tryp_SPc 55..261 CDD:304450 53/231 (23%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 57/243 (23%)
Tryp_SPc 45..284 CDD:238113 56/245 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.