DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and KLK7

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_005037.1 Gene:KLK7 / 5650 HGNCID:6368 Length:253 Species:Homo sapiens


Alignment Length:266 Identity:68/266 - (25%)
Similarity:116/266 - (43%) Gaps:38/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVSCLLWTCLPQSQGTVYPRDILLKTPKFRRVWGGVQSNTGPNFGGWLLRILNGDGNFACGAAY 72
            ||:|..|.|...::||.              ::..|.....|.:  .|.:.:|:|: ...||...
Human    12 LLLSLALETAGEEAQGD--------------KIIDGAPCARGSH--PWQVALLSGN-QLHCGGVL 59

  Fly    73 YAPLLVITSANCIYPYRNSLEGATVEGTAFSECDRENYADIDTIQFPEKFIY-----QKLYMDVA 132
            .....|:|:|:|      .:...||...:.:..||.    ...|:..:.|.:     |....|:.
Human    60 VNERWVLTAAHC------KMNEYTVHLGSDTLGDRR----AQRIKASKSFRHPGYSTQTHVNDLM 114

  Fly   133 VVRLRDPVR-GRLTEFIRLCSVKVQPKMQMVVFGWGFDNT-EVEIPSSDPRNVTVTIISIKECRQ 195
            :|:|....| ..:.:.:||.|....|.....|.|||...: :|..| ||...|.|.:||.::|.:
Human   115 LVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFP-SDLMCVDVKLISPQDCTK 178

  Fly   196 KFKSPKIASTSICARQPKNPKQ-CLYDGGSPLIYGRELCGVVSFGSH-CIDTSRPGMYTNIRRVK 258
            .:|. .:.::.:||..|.:.|. |..|.|.||:....|.|:||:|:. |...:.||:||.:.:..
Human   179 VYKD-LLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFT 242

  Fly   259 RFITET 264
            ::|.:|
Human   243 KWINDT 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 59/230 (26%)
Tryp_SPc 55..261 CDD:304450 57/214 (27%)
KLK7NP_005037.1 Tryp_SPc 29..245 CDD:214473 59/230 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.