DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and PRSS3

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:218 Identity:51/218 - (23%)
Similarity:97/218 - (44%) Gaps:29/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEG-------ATVEGTAFSECDRENYADIDTIQ 117
            ||...:| ||.:..:...|:::|:|   |:..::.       ..:||       .|.:.:...|.
Human   127 LNSGSHF-CGGSLISEQWVVSAAHC---YKTRIQVRLGEHNIKVLEG-------NEQFINAAKII 180

  Fly   118 FPEKFIYQKLYMDVAVVRLRDP--VRGRLTEFIRLCSVKVQPKMQMVVFGWGFDNT---EVEIPS 177
            ...|:....|..|:.:::|..|  :..|::. |.|.:.......:.::.|||  ||   ..:.| 
Human   181 RHPKYNRDTLDNDIMLIKLSSPAVINARVST-ISLPTTPPAAGTECLISGWG--NTLSFGADYP- 241

  Fly   178 SDPRNVTVTIISIKECRQKFKSPKIASTSICARQPKNPK-QCLYDGGSPLIYGRELCGVVSFGSH 241
            .:.:.:...:::..||:..:.. ||.::..|....:..| .|..|.|.|::...:|.||||:|..
Human   242 DELKCLDAPVLTQAECKASYPG-KITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHG 305

  Fly   242 CIDTSRPGMYTNIRRVKRFITET 264
            |...:|||:||.:.....:|.:|
Human   306 CAWKNRPGVYTKVYNYVDWIKDT 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 49/213 (23%)
Tryp_SPc 55..261 CDD:304450 49/213 (23%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 49/213 (23%)
Tryp_SPc 110..328 CDD:238113 50/216 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.