DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and PRSS1

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:297 Identity:67/297 - (22%)
Similarity:118/297 - (39%) Gaps:69/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LLKTPKFRR-----VWGGVQSNTGPNFGGWLLRILNGDGNFACGAAYYA---PLLVIT------- 80
            |::.|..|:     |.|||.:.|..:...|:| :...|.:.....|:..   |||::|       
Human   177 LMQDPGKRKAAGVFVLGGVVTLTSQSPPLWIL-VRYKDESSTTSQAHSTTMNPLLILTFVAAALA 240

  Fly    81 -----------SANC---IYPYRNSLEGA--TVEGTAFSE--------CDRENYA------DIDT 115
                       ..||   ..||:.||...  ...|:..:|        |.:....      :|:.
Human   241 APFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEV 305

  Fly   116 IQFPEKFI----------YQK--LYMDVAVVRL--RDPVRGRLTEFIRLCSVKVQPKMQMVVFGW 166
            ::..|:||          |.:  |..|:.:::|  |..:..|::. |.|.:.......:.::.||
Human   306 LEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVST-ISLPTAPPATGTKCLISGW 369

  Fly   167 GFDNTE---VEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSICARQPKNPK-QCLYDGGSPLI 227
            |  ||.   .:.| .:.:.:...::|..:|...:.. ||.|...|....:..| .|..|.|.|::
Human   370 G--NTASSGADYP-DELQCLDAPVLSQAKCEASYPG-KITSNMFCVGFLEGGKDSCQGDSGGPVV 430

  Fly   228 YGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITET 264
            ...:|.||||:|..|...::||:||.:....::|..|
Human   431 CNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNT 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 62/284 (22%)
Tryp_SPc 55..261 CDD:304450 57/263 (22%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 49/220 (22%)
Tryp_SPc 249..467 CDD:238113 50/222 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.