DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and PROC

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_024308770.1 Gene:PROC / 5624 HGNCID:9451 Length:576 Species:Homo sapiens


Alignment Length:233 Identity:56/233 - (24%)
Similarity:90/233 - (38%) Gaps:48/233 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 WLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFSECDRENYA--DIDTIQ 117
            |.:.:|:.....||||....|..|:|:|:|:...:..|       ....|.|...:.  ::| :.
Human   340 WQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLL-------VRLGEYDLRRWEKWELD-LD 396

  Fly   118 FPEKFI---YQKLYM--DVAVVRLRDPVRGRLTEFIRLCSVKV--------QPKMQMVVFGWGFD 169
            ..|.|:   |.|...  |:|::.|..|.....| .:.:|....        |...:.:|.|||:.
Human   397 IKEVFVHPNYSKSTTDNDIALLHLAQPATLSQT-IVPICLPDSGLAERELNQAGQETLVTGWGYH 460

  Fly   170 NTEVEIPSSDPRNVTVTIISIK-------ECRQKFKSPKIASTSICA-----RQPKNPKQCLYDG 222
            ::.   .....||.|..:..||       || .:..|..::...:||     ||    ..|..|.
Human   461 SSR---EKEAKRNRTFVLNFIKIPVVPHNEC-SEVMSNMVSENMLCAGILGDRQ----DACEGDS 517

  Fly   223 GSPLIYGRE----LCGVVSFGSHCIDTSRPGMYTNIRR 256
            |.|::....    |.|:||:|..|......|:||.:.|
Human   518 GGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSR 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 56/233 (24%)
Tryp_SPc 55..261 CDD:304450 56/233 (24%)
PROCXP_024308770.1 GLA 117..168 CDD:214503
EGF_CA 182..213 CDD:238011
FXa_inhibition 255..290 CDD:317114
Tryp_SPc 328..563 CDD:238113 56/233 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.