DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and LOC558805

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_021329158.1 Gene:LOC558805 / 558805 -ID:- Length:255 Species:Danio rerio


Alignment Length:237 Identity:50/237 - (21%)
Similarity:96/237 - (40%) Gaps:49/237 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ILNG----------------DGNFACGAAYYAPLLVITSANC---------IYPYRNSLEGATVE 98
            |:||                :|...||.....|..|:|:|:|         :..:..|.:|..|:
Zfish    26 IINGKKAKKSSLLYMASVQINGEHKCGGFLIDPSYVLTAAHCNKQGNMSVILGTHDISPKGTNVK 90

  Fly    99 GTAFSECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFIRLCS--VKVQPKMQM 161
              .:...::..:....:::..:..:..|||..|.:        |:..:.:.:.|  ..::||.:.
Zfish    91 --RYRVQNKHIHPSYKSVKTGKDIMLLKLYKKVKI--------GKDVKLVTIPSKDKPLKPKSKC 145

  Fly   162 VVFGWG---FDNTEVEIPSSDPRNVTVTIISIKECRQKFK--SPKIASTSICARQPKNPK-QCLY 220
            :|.|||   .|||..::..:|...:..|:     |:..:|  :.::....:||...:... .|..
Zfish   146 LVAGWGKTEKDNTVNDLLVTDVLTINKTV-----CQSVWKKINVELPDNILCAGGYETKSGACQG 205

  Fly   221 DGGSPLIYGRELCGVVSFG-SHCIDTSRPGMYTNIRRVKRFI 261
            |.|.||:...:..|:|||. ..|...:.|.:||.|.:...:|
Zfish   206 DSGGPLVCSGQAVGIVSFNMGRCDYPNTPNIYTQISKYTHWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 49/235 (21%)
Tryp_SPc 55..261 CDD:304450 49/235 (21%)
LOC558805XP_021329158.1 Tryp_SPc 26..250 CDD:238113 50/237 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.