DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and PLAU

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_002649.2 Gene:PLAU / 5328 HGNCID:9052 Length:431 Species:Homo sapiens


Alignment Length:293 Identity:70/293 - (23%)
Similarity:120/293 - (40%) Gaps:43/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVSCLLWTCLPQSQGTVYPRDILL----KT--PKFRRVWGGVQS-NTGPNFGGWLLRILNGDGN 65
            |:..|::..|....:.:..|.::..    ||  |:|:.:.|...: ...|.|.....|...|...
Human   142 LVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVT 206

  Fly    66 FACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFSECDRENYADIDTIQFP-EKFIYQKLYM 129
            :.||.:..:|..||::.:|...|....:.....|.:     |.|......::|. |..|..|.|.
Human   207 YVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRS-----RLNSNTQGEMKFEVENLILHKDYS 266

  Fly   130 --------DVAVVRLRDPVRGRLTEFIRLCSVKVQPKM--------QMVVFGWGFDNTEVEIPSS 178
                    |:|::::|.. .||..:..|.......|.|        ...:.|:|.:|:...:...
Human   267 ADTLAHHNDIALLKIRSK-EGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPE 330

  Fly   179 DPRNVTVTIISIKECRQ-KFKSPKIASTSICARQPK-NPKQCLYDGGSPLI---YGR-ELCGVVS 237
            ..:...|.:||.:||:| .:...::.:..:||..|: ....|..|.|.||:   .|| .|.|:||
Human   331 QLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVS 395

  Fly   238 FGSHCIDTSRPGMYTNIRRVKRFI----TETEE 266
            :|..|....:||:||   ||..|:    :.|:|
Human   396 WGRGCALKDKPGVYT---RVSHFLPWIRSHTKE 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 59/245 (24%)
Tryp_SPc 55..261 CDD:304450 56/228 (25%)
PLAUNP_002649.2 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 34..57
KR 67..152 CDD:238056 2/9 (22%)
Connecting peptide 152..177 4/24 (17%)
Tryp_SPc 179..422 CDD:238113 60/251 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.