DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and Prss53

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:249 Identity:62/249 - (24%)
Similarity:99/249 - (39%) Gaps:47/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GVQSNTGPNFGG-----WLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAF 102
            |..|:.||..|.     |..| |...|..|||.|..:.::|:|:|:| :..|.:||..:| |...
  Rat   336 GSLSSGGPQAGALSQWPWDAR-LKHHGKLACGGALVSEVVVLTAAHC-FIGRQTLEEWSV-GLGA 397

  Fly   103 SECDRENYADIDTIQFPEKFIYQKLYM-----------DVAVVRLRDPVRGRLTEFIR-LCSVKV 155
            .               ||::..::|.:           |||.:.|..||  .|...:| ||....
  Rat   398 G---------------PEEWGLKQLILHGAYTHPEGGHDVAFLLLAQPV--TLGPGLRPLCLPYA 445

  Fly   156 QPKMQMVVFGWGFDNTEVEIPSSDPRNVTVTIISIKEC-RQKFKSPK----IASTSICARQPKNP 215
            ..::.....||....|. |...:.|..|.||::....| ||...|..    |....||......|
  Rat   446 DHRLPDGEHGWVLGLTR-EAGINHPHTVPVTVLGPMACSRQHAASGSTGVPILPGMICTTVVGEP 509

  Fly   216 KQCLYDGGSPLIYGRE----LCGVVSFGSHCIDTSRPGMYTNIRRVKRFITETE 265
            ..|....|:||::...    |.|:.|||..|..:::|.::..:...:.:::..:
  Rat   510 PHCEGLSGAPLVHEIRGTWFLAGLHSFGDTCQGSAKPAVFAALSAYEDWVSNLD 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 62/243 (26%)
Tryp_SPc 55..261 CDD:304450 57/226 (25%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113
Tryp_SPc 341..561 CDD:238113 60/240 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.