DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and Tmprss11f

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_038948844.1 Gene:Tmprss11f / 498345 RGDID:1560675 Length:459 Species:Rattus norvegicus


Alignment Length:223 Identity:57/223 - (25%)
Similarity:90/223 - (40%) Gaps:37/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFSE--CDRENYADIDTIQFPEKF 122
            |.|.|: .|||...:...::|:|:|.:..|:..:.....||..:.  ..|    .:..|...|::
  Rat   247 LIGAGH-QCGATLISNTWLLTAAHCFWKNRDPSKWIATFGTTITPPLVKR----SVGRIIIHEEY 306

  Fly   123 IYQKLYMDVAVVRLRDPVRGRLTEFI----RLC----SVKVQPKMQMVVFGWGFDNTEVEIPSSD 179
            .......|:|:.:|...|     ||.    |:|    |:|:.||..:.|.|:|      .|....
  Rat   307 HRDSNENDIALAQLTSRV-----EFSNVVQRVCLPDSSMKLPPKTSVFVTGFG------SIVDDG 360

  Fly   180 P-----RNVTVTIISIKECRQK-FKSPKIASTSICAR-QPKNPKQCLYDGGSPLIYGRE----LC 233
            |     |...|..|....|.|| .....|....:||. .......|..|.|.||:|...    :.
  Rat   361 PTQNKLRQARVETIGSDVCNQKDVYDGLITPGMLCAGFMEGKVDACKGDSGGPLVYDNRDIWYIV 425

  Fly   234 GVVSFGSHCIDTSRPGMYTNIRRVKRFI 261
            |:||:|..|...::||:||.:.:.:.:|
  Rat   426 GIVSWGQSCALPNKPGVYTRVSKYRDWI 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 56/221 (25%)
Tryp_SPc 55..261 CDD:304450 56/221 (25%)
Tmprss11fXP_038948844.1 SEA 80..185 CDD:396113
Tryp_SPc 227..456 CDD:238113 57/223 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.