DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and AgaP_AGAP001248

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_001238557.2 Gene:AgaP_AGAP001248 / 4577294 VectorBaseID:AGAP001248 Length:271 Species:Anopheles gambiae


Alignment Length:225 Identity:62/225 - (27%)
Similarity:95/225 - (42%) Gaps:46/225 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 NFACGAAYYAPLLVITSANCIYPYRNSLEGATV---------EGTAFSECDRENYA----DIDTI 116
            |..|.|:..:.|...|.|:|.|.:: ||.|.|:         .|..|...|  |:.    |.||.
Mosquito    65 NHICTASIISTLHAATGAHCTYSFK-SLSGVTIYAGSTSRTTGGRVFVVTD--NFIHPKYDPDTF 126

  Fly   117 QFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFIRLCSVKVQP-------KMQMVVFGWGFDNTEVE 174
            .|           ||||:|::.|    .|..:.:.||.:.|       |:|..|.|||..:|...
Mosquito   127 DF-----------DVAVLRVKTP----FTPNMNIASVPLVPANYAVPDKVQPTVAGWGRTSTGGT 176

  Fly   175 IPSSDPRNVTVTIISIKECRQKFKSPKIASTSICARQPKNPKQCLYDGGSPLIYGR----ELCGV 235
            : |...|.|.:.:|....|::.:....|....:|| ..|....|..|.|.||:...    :|.|:
Mosquito   177 L-SPTLRAVAIPVIGNIPCQELWIDTDITDNMLCA-GAKGRDACTGDSGGPLVVPTTNYFQLVGI 239

  Fly   236 VSFGSHCIDTSRPGMYTNIR--RVKRFITE 263
            ||:||....:..||:||.:.  .::.|:.:
Mosquito   240 VSWGSAACGSEYPGVYTRMASPSIQSFLAQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 61/221 (28%)
Tryp_SPc 55..261 CDD:304450 61/221 (28%)
AgaP_AGAP001248XP_001238557.2 Tryp_SPc 42..260 CDD:214473 61/214 (29%)
Tryp_SPc 43..257 CDD:238113 60/211 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.