DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG34130

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:229 Identity:66/229 - (28%)
Similarity:122/229 - (53%) Gaps:20/229 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GVQSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFSECDR 107
            |::..:|.:...|||||::|. .|.|||:|.:.|..:|||||::.:|:.:|..:|| ...|:..:
  Fly    45 GIRRTSGGHAVPWLLRIVDGP-TFVCGASYLSALYALTSANCMHSHRSQMESLSVE-LVSSDSRQ 107

  Fly   108 ENYAD--------IDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFIRLCS--VKVQPKMQMV 162
            :|..|        |..|...:.:.:...:|||||:.|.:.:||....::.||:  :.....:.:|
  Fly   108 DNQLDSHDPPNALIRNIIVSKDWHWPGTFMDVAVIELTNRLRGNRNNYVTLCTNPLSSYKSLSVV 172

  Fly   163 VFGWGFDNTEVEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSICARQPKNPKQCLYDGGSPLI 227
            .:|.|        |:.:.|...:.:::...|...:.:..:..|..||::.|....|::..|.|:.
  Fly   173 SYGAG--------PAENVRTEEIEVLNRMICDSAYGNFLLRETVACAKEFKRSADCMFSAGCPVT 229

  Fly   228 YGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFI 261
            .|.:|||:|::...|..::.||::|:|.:|||||
  Fly   230 AGDQLCGIVAWSPACKRSNLPGIFTDIHQVKRFI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 64/227 (28%)
Tryp_SPc 55..261 CDD:304450 62/215 (29%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 62/219 (28%)
Tryp_SPc 53..256 CDD:304450 58/212 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.