DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and Gm5771

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001034086.1 Gene:Gm5771 / 436523 MGIID:3646222 Length:245 Species:Mus musculus


Alignment Length:236 Identity:56/236 - (23%)
Similarity:97/236 - (41%) Gaps:43/236 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GGWLLR--------ILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEG-------ATVEGTAF 102
            ||:..|        .||...:| ||.:......|:::|:|   |:..::.       ..:||   
Mouse    25 GGYTCRENSVPYQVSLNSGYHF-CGGSLINDQWVVSAAHC---YKTRIQVRLGEHNIKVLEG--- 82

  Fly   103 SECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFIRLCSVKVQPK-----MQMV 162
                .|.:.:...|.....|..:.|..|:.:::|..||    |...|:.:|.:...     .|.:
Mouse    83 ----NEQFVNAAKIIKHPNFNRKTLNNDIMLIKLSSPV----TLNARVATVALPSSCAPAGTQCL 139

  Fly   163 VFGWGFDNTEVEIPSSDP---RNVTVTIISIKECRQKFKSPKIASTSICARQPKNPK-QCLYDGG 223
            :.|||  || :....|:|   :.:...::...:|...:.. ||....:||...:..| .|..|.|
Mouse   140 ISGWG--NT-LSFGVSEPDLLQCLDAPLLPQADCEASYPG-KITGNMVCAGFLEGGKDSCQGDSG 200

  Fly   224 SPLIYGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITET 264
            .|::...||.|:||:|..|.....||:||.:.....:|.:|
Mouse   201 GPVVCNGELQGIVSWGYGCALADNPGVYTKVCNYVDWIQDT 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 54/231 (23%)
Tryp_SPc 55..261 CDD:304450 52/229 (23%)
Gm5771NP_001034086.1 Tryp_SPc 22..238 CDD:214473 54/231 (23%)
Tryp_SPc 23..241 CDD:238113 55/234 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.