DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and intr

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:229 Identity:46/229 - (20%)
Similarity:77/229 - (33%) Gaps:68/229 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 WLLRILNGDGNFACGAAYYAPLLVITSANC---------------------IYPYRNSLEGATVE 98
            :::|||. :....|..|..:..||:|||.|                     ||...|.:.|| :|
  Fly   101 FVMRILY-ENKVICSGALISTRLVLTSALCFPRTLRQPPPRSYKLQASRSRIYSVANLITGA-IE 163

  Fly    99 GTAFSECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFIRLCSVKVQPKMQMVV 163
                                           |:|::.|..|:.......|.||...::..     
  Fly   164 -------------------------------DMALLLLHAPLEDPFVHPIDLCESPLRRN----- 192

  Fly   164 FGWGFDNTEVEIPSSDPRNVTVTIISIKECRQKFKSPK---IASTSICARQPKNPKQCLYDGGSP 225
                 ||..:.:.....|.:...:|....|::.:...:   |..|.:||........|....|..
  Fly   193 -----DNVTMYMSQQHLRFLRTKLIPNSNCKRSYAQDENAFITQTMLCALNSNRLVDCQTAKGDV 252

  Fly   226 LIYGRELCGVVSFGSHCIDTSRPG-MYTNIRRVK 258
            |::...||||..:|.||.|....| :|.::.:.:
  Fly   253 LLHQDRLCGVDIYGQHCSDGGVNGELYADVFKAR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 46/229 (20%)
Tryp_SPc 55..261 CDD:304450 46/229 (20%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 43/213 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.