DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG4815

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:277 Identity:71/277 - (25%)
Similarity:121/277 - (43%) Gaps:41/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WLLVSCLL--------------WTCLPQSQGTVYPRDILLKTPKFRRVWGGVQSNTGPNFGGWLL 57
            |.||..||              ||      |..:|           |::.|::: |..:.||..:
  Fly     5 WTLVRLLLILNSVRTEAGNREEWT------GRFHP-----------RIYNGIKT-TVESLGGVGI 51

  Fly    58 RILNGDGNFACGAAYYAPLLVITSANCIYPYRNS----LEGATVEGTAFSECDRENYADIDTIQF 118
            ::.|| ....|.|....|..::|:|:|......|    :.|.:.|.|.......:|  .:..:|.
  Fly    52 QLFNG-RKLVCSATLLTPRHILTAAHCFENLNRSKFHVIGGKSAEFTWHGNNFNKN--KLIRVQI 113

  Fly   119 PEKFIYQKLYMDVAVVRLRDPVRGRLTEFIRLCSVKVQPKMQMVVFGWGFD-NTEVEIPSSDPRN 182
            ..|:...|...||||.:.:.|:|.:...:.:||...:.|:.:::..||||: ....|......|:
  Fly   114 HPKYAKMKFIADVAVAKTKYPLRSKYIGYAQLCRSVLHPRDKLIAAGWGFEGGVWDESRKKTFRS 178

  Fly   183 VTVTIISIKECRQKFKSPKIASTSICARQPKNPKQCLYDGGSPLIYGRELCGVVSFGSHCIDTSR 247
            :.|.|:|.::| :|....|:....|||....|...|..|.|.||:.||::||:.::...|.:..:
  Fly   179 MKVGIVSKRDC-EKQLDRKMPPNIICAGAYNNKTLCFGDSGGPLLLGRQVCGINTWTFKCGNNEK 242

  Fly   248 PGMYTNIRRVKRFITET 264
            |.:|..:|...:||..|
  Fly   243 PDVYMGVRYYAKFIKRT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 59/226 (26%)
Tryp_SPc 55..261 CDD:304450 54/210 (26%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 56/213 (26%)
Trypsin 49..256 CDD:278516 54/210 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.