DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG16749

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:249 Identity:56/249 - (22%)
Similarity:106/249 - (42%) Gaps:30/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PKFRRVWGGVQSNTG--PNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATV 97
            |:..||..|..|:..  |    :::.:....|:.:||.:..:...|:|:|:|. ..|.:.:.:..
  Fly    25 PQMGRVVNGTDSSVEKYP----FVISMRGSSGSHSCGGSIISKQFVMTAAHCT-DGRKASDLSVQ 84

  Fly    98 EGTAFSECDRENYADI-DTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEF--IRLCSVKVQPKM 159
            .|.........|...: ..||..:...|.....|::::.:.:|.     ||  :.:..||: |::
  Fly    85 YGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPF-----EFDGVTVAPVKL-PEL 143

  Fly   160 -----------QMVVFGWGFDNTEVEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSICARQPK 213
                       :.|:.|||.:.|...|.|: .:.|.:.:.|.:||.::..........||....:
  Fly   144 AFATPQTDAGGEGVLIGWGLNATGGYIQST-LQEVELKVYSDEECTERHGGRTDPRYHICGGVDE 207

  Fly   214 NPK-QCLYDGGSPLIYGRELCGVVSFG-SHCIDTSRPGMYTNIRRVKRFITETE 265
            ..| ||..|.|.||||..:..|:||:. ..|.....||:|..:.:...:|.:::
  Fly   208 GGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKKSQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 54/239 (23%)
Tryp_SPc 55..261 CDD:304450 49/221 (22%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 54/239 (23%)
Tryp_SPc 30..259 CDD:238113 54/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.