DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG12951

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:253 Identity:60/253 - (23%)
Similarity:102/253 - (40%) Gaps:38/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PKFRRVWGGVQSNT--GPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCI-----------Y 86
            |...||..|..|:.  .|    :::.:.:.||:.:||.:..:...|:|:|:|.           :
  Fly    25 PSISRVVNGTDSSVLKYP----FVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPADTLSIQF 85

  Fly    87 PYRN-SLEGATVEG----TAFSECD--RENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRL 144
            ...| |..|..|.|    ....:.|  |:|..||..:...|.|.:..  :.||.|.|  |.    
  Fly    86 GVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDG--VSVAPVEL--PA---- 142

  Fly   145 TEFIRLCSVKVQPKMQMVVFGWGFDNTEVEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSICA 209
               :.....:....::.|:.|||.::|...:..: .:.|::.|.|.:||..:..........||.
  Fly   143 ---LAFAVPQSDAGVEGVLIGWGLNDTYGSVQDT-LQEVSLKIYSDEECTSRHNGQTDPKYHICG 203

  Fly   210 RQPKNPK-QCLYDGGSPLIYGRELCGVVSFG-SHCIDTSRPGMYTNIRRVKRFITETE 265
            ...:..| ||..|.|.||||..:..|:||:. ..|.....||:|..:.:...:|...:
  Fly   204 GVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKSNQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 58/243 (24%)
Tryp_SPc 55..261 CDD:304450 53/225 (24%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 58/243 (24%)
Tryp_SPc 30..260 CDD:238113 58/245 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.