DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG4914

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:247 Identity:66/247 - (26%)
Similarity:109/247 - (44%) Gaps:33/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RVWGGVQSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFS 103
            |:.||  :.||.:...|:.| |:....|.||........|:|:|:|:..:...:...|     |.
  Fly   127 RIVGG--TTTGVSEYPWMAR-LSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVT-----FG 183

  Fly   104 ECDRENYADIDTIQ-----FPEKFIYQKLYMDVAVVRLRDPVRGRLTEFIR-LCSVKVQPKMQM- 161
            |.||.|..:....:     |.:||.:.....|:|::||.|  |..:|.||| :|..:|:.:..: 
  Fly   184 EHDRCNDKERPETRFVLRAFSQKFSFSNFDNDIALLRLND--RVPITSFIRPICLPRVEQRQDLF 246

  Fly   162 -----VVFGWGFDNTEVEIPSSDPRNVTVTIISIKEC--RQKFKSPKIASTSICARQP--KNPKQ 217
                 :..|||....:.: ||...:.|.|.::...||  :..:....|....:|:..|  .....
  Fly   247 VGTKAIATGWGTLKEDGK-PSCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGRDS 310

  Fly   218 CLYDGGSPLIYGR------ELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITE 263
            |..|.|.||:..|      |..|:||:|:.|...:.||:||.:.:...:|.|
  Fly   311 CQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWIVE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 64/243 (26%)
Tryp_SPc 55..261 CDD:304450 59/227 (26%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 64/243 (26%)
Tryp_SPc 128..363 CDD:238113 65/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.