DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and cfd

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_989320.1 Gene:cfd / 394945 XenbaseID:XB-GENE-973605 Length:265 Species:Xenopus tropicalis


Alignment Length:289 Identity:59/289 - (20%)
Similarity:110/289 - (38%) Gaps:72/289 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WLLVSCLL------WTCLPQSQGTVYPRDILLKTPKFRRVWGGVQS--NTGPNFGGWLLRILNGD 63
            |.|::.:|      :.|.|:.                 |:.||..|  ...|     .:..:..:
 Frog     5 WALLAVVLVLTVATYECRPRG-----------------RILGGQDSKAEVRP-----YMASIQQN 47

  Fly    64 GNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFSECDRENYADIDTIQFPEKF-IYQKL 127
            |...||....|...|:::|:|.....||.....:...:.|:              |||: |..|:
 Frog    48 GIHQCGGVLIADKWVLSAAHCATNSSNSSLNVMLGAISLSK--------------PEKYKIVVKV 98

  Fly   128 YMDV------AVVRLRDPVRGRLTEFIRLC-----------SVKVQPKMQMVVFGWGFDNTEVEI 175
            ..::      :.::..|.:...|:|.:.|.           ::.:....:.:|.|||    ::.:
 Frog    99 LREIPHPLYNSTIKHHDLLLLELSEKVTLSPAVNPLPFQNENIDISAGKRCLVAGWG----QMRL 159

  Fly   176 PSSDP---RNVTVTIISIKEC-RQKFKSPKIASTSICARQPKNPKQCLYDGGSPLIYGRELCGVV 236
            ....|   :.:.|.:||...| |:.:...:|.:..|||.:.:. ..|..|.|.||:.......:|
 Frog   160 TGKKPDTLQELWVPLISRDVCNRRNYYDNEITANMICAGESRK-DSCEGDSGGPLVCDGIAVAIV 223

  Fly   237 SFG-SHCIDTSRPGMYTNIRRVKRFITET 264
            ..| ..|.:.::||:||.|...|.:|.|:
 Frog   224 QGGFRKCGNPTKPGIYTLIEPYKSWIMES 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 52/246 (21%)
Tryp_SPc 55..261 CDD:304450 47/228 (21%)
cfdNP_989320.1 Tryp_SPc 27..251 CDD:238113 52/247 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.