DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG32374

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:297 Identity:71/297 - (23%)
Similarity:125/297 - (42%) Gaps:53/297 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSKIWLLV---SCLLWTCLPQSQGTVYPRDILLKTPKFRR---VWGGVQSNTGPN---FGGWL-L 57
            ::.:|:||   ....|:......||.|   :|.:.|:.:.   :.|.:.:|...|   ...:| .
  Fly    11 IANLWILVVGGQSKNWSGYYVDNGTHY---LLYEGPRIKPQTFLPGNISTNPAINALEAQDYLPT 72

  Fly    58 RILNG----------------DGNFACGAAYYAPLLVITSANCIY--PYRNSLEGATVE---GTA 101
            ||:||                :..|.||........::|:.:|..  |.|.::...:.:   |..
  Fly    73 RIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPGRYTVRAGSTQQRRGGQ 137

  Fly   102 FSECDRENYADIDTIQFPEKFIYQKLYM--DVAVVRLRDPVR-GRLTEFIRLCSVKVQ--PKMQM 161
            .....:       |:..|.   |.:..|  |:.:::|:.|:. ||..:.::|.|.:.:  ||..:
  Fly   138 LRHVQK-------TVCHPN---YSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCYL 192

  Fly   162 VVFGWGFDNTEVEIPSSDPRNVTVTIISIKECRQKFKSP--KIASTSICARQPKNPKQCLYDGGS 224
             ..|||..:...:......|.|.|..:|..:|:|.::..  ||....|||:: ||...|..|.|.
  Fly   193 -ASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKR-KNRDTCSGDSGG 255

  Fly   225 PLIYGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFI 261
            ||::...|.|:.|||..|.....||:|.|:.:..|:|
  Fly   256 PLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 61/256 (24%)
Tryp_SPc 55..261 CDD:304450 58/234 (25%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 57/230 (25%)
Tryp_SPc 74..295 CDD:238113 57/231 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.