DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG32270

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:205 Identity:58/205 - (28%)
Similarity:99/205 - (48%) Gaps:8/205 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 GNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFSECDRENYADIDTIQFPEKFIYQKLY 128
            |||.||.:...|..|:|:|:|:.....|  ...|.|......|..|...:..|..|..:....|.
  Fly    52 GNFECGGSLVTPRCVLTAAHCLNDGNPS--DFVVRGGVTYLSDMRNSRYVRKILMPSAYSRTTLD 114

  Fly   129 MDVAVVRLRDPVRGRLTEFIRLCSVKVQPKMQMVVFGWGF-DNTEVEIPSSDPRNVTVTIISIKE 192
            .|||:::|:.|::..:.:.|.|.....:|...:.|.|||. |::...:| :..::|.|.::..:|
  Fly   115 HDVALLQLKQPLQASIAKPISLAVRSPRPGSFVRVSGWGLTDSSSTSLP-NQLQSVHVQVMPQRE 178

  Fly   193 CRQKFKSPK-IASTSICARQPKNPKQCLYDGGSPLIYGRE-LCGVVSFG-SH-CIDTSRPGMYTN 253
            ||..::..: |.|:..||..|.....|..|.|.|::.... |.||||:| :| |.....||:|::
  Fly   179 CRDLYRGYRNITSSMFCASVPGLKDACAGDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSD 243

  Fly   254 IRRVKRFITE 263
            :..:..:|.:
  Fly   244 VSYLSDWIAD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 57/201 (28%)
Tryp_SPc 55..261 CDD:304450 57/201 (28%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 57/201 (28%)
Tryp_SPc 31..254 CDD:238113 58/205 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.