DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG9897

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:285 Identity:57/285 - (20%)
Similarity:83/285 - (29%) Gaps:132/285 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 WLL----RILNG----------------DGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEG 99
            ||.    ||:||                :....||.|..:...::|:|.|:..|           
  Fly    15 WLALGDQRIINGNTVNIKDAPWYASIIVNSKLKCGGAIISKNYILTAAKCVDGY----------- 68

  Fly   100 TAFSECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFIRLCSVKVQPKMQMVVF 164
                        ...:||                |||.....|.......:|.|||..:..    
  Fly    69 ------------SARSIQ----------------VRLGTSSCGTSGSIAGICKVKVHSQYS---- 101

  Fly   165 GWGFDNT--------------EV-------EIPSSDPR-NVT----------------------- 184
            .|.|||.              |:       ::|..:.| |||                       
  Fly   102 SWRFDNNLALLKTCELLNTTDEIKPIERADKVPDDNSRANVTGCGGRSGNFLDLILDLRISSGIE 166

  Fly   185 --------------VTIISIKECRQKFK------SPKIASTSICARQPKNPKQCLYDGGSPLIYG 229
                          |.|:|.|:|...:|      ...|:..:||.:.| ....|..|.||||:..
  Fly   167 EKCFQLPVQLHGTQVRILSQKQCAADWKVIPFYLLKGISDLTICTKSP-GKGACSTDRGSPLVID 230

  Fly   230 RELCGVVSFGSHCIDTSRPGMYTNI 254
            .:|.|::|.....|   :|.:|.||
  Fly   231 NKLVGILSRAGCSI---KPDVYANI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 57/285 (20%)
Tryp_SPc 55..261 CDD:304450 57/285 (20%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 55/278 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.