DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG32833

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:245 Identity:51/245 - (20%)
Similarity:97/245 - (39%) Gaps:38/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RRVWGG--VQSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGT 100
            |...||  |...|.|    |:..| :......|..|.|....::|:..|:..:.|.:....|..|
  Fly    36 RTTLGGHPVNITTAP----WIASI-SIKQKAKCDGAIYKLSHIVTAGKCVDGFLNKVIRVRVGST 95

  Fly   101 AFSECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLT-EFIRLCSVKVQPKMQMVVF 164
            ..|:...|  ..:..|...|||..|.::.:||:::|.:|:....| :.|:|.:.......::...
  Fly    96 TRSDGVIE--VAVCNITVHEKFTGQTVFHNVAILKLCEPLEASKTIQPIQLANQLPSNGAKVTAN 158

  Fly   165 GWG------------FDNTEVEIPSSDPRNVTVTIISIKEC-----RQKFKSPKIASTSICARQP 212
            ||.            .|:...::..::     |.::...:|     |..:..........|..  
  Fly   159 GWPSFRWWAMYWKKCLDDEAYKLQKAE-----VKLLGPSQCTDLWARNNWSKKNFTDDLFCTE-- 216

  Fly   213 KNPKQ-CLYDGGSPLIYGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFI 261
            |..|: |....|||:::..:|.|:::.|. |  :..|.:|.|:.:.|.::
  Fly   217 KFAKEACSLAMGSPVVHNGKLVGIITKGG-C--SEYPEVYINLIKYKDWL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 50/242 (21%)
Tryp_SPc 55..261 CDD:304450 45/224 (20%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 50/241 (21%)
Tryp_SPc 40..262 CDD:214473 50/238 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.